NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	NKZ66_RS00800	Genome accession	NZ_CP100336
Coordinates	127994..128275 (+)	Length	93 a.a.
NCBI ID	WP_009909092.1	Uniprot ID	A0A116MYU4
Organism	Streptococcus suis strain STC81
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 122994..133275

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NKZ66_RS00780 (NKZ66_00780)	-	124657..125022 (+)	366	WP_024417409.1	DUF1033 family protein	-
NKZ66_RS00785 (NKZ66_00785)	-	125057..126007 (-)	951	WP_024417410.1	S66 peptidase family protein	-
NKZ66_RS00790 (NKZ66_00790)	comYA	126093..127043 (+)	951	WP_024417411.1	competence type IV pilus ATPase ComGA	Machinery gene
NKZ66_RS00795 (NKZ66_00795)	comYB	126955..127992 (+)	1038	WP_255195823.1	competence type IV pilus assembly protein ComGB	Machinery gene
NKZ66_RS00800 (NKZ66_00800)	comYC	127994..128275 (+)	282	WP_009909092.1	competence type IV pilus major pilin ComGC	Machinery gene
NKZ66_RS00805 (NKZ66_00805)	comGD	128256..128663 (+)	408	WP_024387070.1	competence type IV pilus minor pilin ComGD	-
NKZ66_RS00810 (NKZ66_00810)	comYE	128635..128928 (+)	294	WP_024390433.1	competence type IV pilus minor pilin ComGE	Machinery gene
NKZ66_RS00815 (NKZ66_00815)	comGF/cglF	128915..129349 (+)	435	WP_063725150.1	competence type IV pilus minor pilin ComGF	Machinery gene
NKZ66_RS00820 (NKZ66_00820)	comGG	129327..129737 (+)	411	WP_009909099.1	competence type IV pilus minor pilin ComGG	-
NKZ66_RS00825 (NKZ66_00825)	comYH	129794..130747 (+)	954	WP_024409299.1	class I SAM-dependent methyltransferase	Machinery gene
NKZ66_RS00830 (NKZ66_00830)	-	130797..131984 (+)	1188	WP_014637319.1	acetate kinase	-
NKZ66_RS00835 (NKZ66_00835)	-	132299..132850 (+)	552	WP_024417413.1	folate family ECF transporter S component	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10320.28 Da Isoelectric Point: 8.4284

                                >NTDB_id=704533 NKZ66_RS00800 WP_009909092.1 127994..128275(+) (comYC) [Streptococcus suis strain STC81]

MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKKGDAAVVKVVESQMELYELEHDKEATVADLQAAGYI

TEKQAKQYAAAKK

Nucleotide

Download Length: 282 bp

                                >NTDB_id=704533 NKZ66_RS00800 WP_009909092.1 127994..128275(+) (comYC) [Streptococcus suis strain STC81]

ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCT

CTTGCTCCTTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCGGCTGTTGTCAAAGTAG

TGGAGAGCCAGATGGAGCTCTATGAATTGGAACATGACAAGGAAGCAACGGTGGCAGACTTGCAGGCAGCTGGCTACATC

ACTGAAAAACAAGCAAAACAGTATGCTGCGGCGAAAAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A116MYU4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus suis isolate S10	96.774	100	0.968
comGC/cglC	Streptococcus mitis SK321	67.059	91.398	0.613
comGC/cglC	Streptococcus mitis NCTC 12261	67.059	91.398	0.613
comYC	Streptococcus gordonii str. Challis substr. CH1	62.637	97.849	0.613
comGC/cglC	Streptococcus pneumoniae R6	69.136	87.097	0.602
comGC/cglC	Streptococcus pneumoniae D39	69.136	87.097	0.602
comGC/cglC	Streptococcus pneumoniae TIGR4	69.136	87.097	0.602
comGC/cglC	Streptococcus pneumoniae Rx1	69.136	87.097	0.602
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	57.955	94.624	0.548
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398

Detailed information NTG0704533