Detailed information NTG0070210

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: JMUB898_RS06685
• Genome accession: NZ_AP018587
• Coordinates: 1380308..1380625 (+)
• Length: 105 a.a.
• NCBI ID: WP_002443081.1
• Uniprot ID: -
• Organism: Staphylococcus caprae strain JMUB898
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1375308..1385625

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JMUB898_RS06655 (JMUB898_1341)	-	1376090..1376293 (+)	204	WP_002443096.1	YqgQ family protein	-
JMUB898_RS06660 (JMUB898_1342)	-	1376290..1377276 (+)	987	WP_002443095.1	ROK family glucokinase	-
JMUB898_RS06665 (JMUB898_1343)	-	1377276..1377599 (+)	324	WP_002443093.1	MTH1187 family thiamine-binding protein	-
JMUB898_RS06670 (JMUB898_1344)	-	1377603..1378226 (+)	624	WP_002443090.1	MBL fold metallo-hydrolase	-
JMUB898_RS06675 (JMUB898_1345)	comGA	1378281..1379255 (+)	975	WP_002443088.1	competence type IV pilus ATPase ComGA	Machinery gene
JMUB898_RS06680 (JMUB898_1346)	comGB	1379227..1380294 (+)	1068	WP_049402080.1	competence type IV pilus assembly protein ComGB	Machinery gene
JMUB898_RS06685 (JMUB898_1347)	comGC	1380308..1380625 (+)	318	WP_002443081.1	competence type IV pilus major pilin ComGC	Machinery gene
JMUB898_RS12775 (JMUB898_1348)	comGD	1380654..1381052 (+)	399	WP_002443080.1	competence type IV pilus minor pilin ComGD	-
JMUB898_RS06695 (JMUB898_1349)	-	1381039..1381332 (+)	294	WP_002443078.1	hypothetical protein	-
JMUB898_RS06700 (JMUB898_1350)	-	1381319..1381747 (+)	429	WP_232018998.1	competence type IV pilus minor pilin ComGF	-
JMUB898_RS06710 (JMUB898_1351)	-	1381916..1382425 (+)	510	WP_002443074.1	shikimate kinase	-
JMUB898_RS06715 (JMUB898_1352)	gcvT	1382651..1383742 (+)	1092	WP_002443072.1	glycine cleavage system aminomethyltransferase GcvT	-
JMUB898_RS06720 (JMUB898_1353)	gcvPA	1383760..1385106 (+)	1347	WP_002443070.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11534.65 Da
• Isoelectric Point: 10.0301

>NTDB_id=70210 JMUB898_RS06685 WP_002443081.1 1380308..1380625(+) (comGC) [Staphylococcus caprae strain JMUB898]
MNLLKKFKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIQELISDG
FIKEGQKNCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=70210 JMUB898_RS06685 WP_002443081.1 1380308..1380625(+) (comGC) [Staphylococcus caprae strain JMUB898]
ATGAACTTATTAAAAAAATTTAAAAAATCCAAAGCTTTTACACTTATTGAAATGTTACTAGTACTTTTAATTATCAGTTT
ATTACTGATTTTAATAATCCCTAATATTGCTAAGCAAACAGCACATATACAATCTACTGGTTGCGATGCACAAGTTAAAA
TGGTAAATAGTCAAATTGAAGCATATGCATTGAAACATAATCGTAACCCGAGTAACATACAAGAATTAATTTCCGACGGT
TTCATTAAAGAAGGACAGAAAAATTGCAAATCAGGGCAAACAATTAGTATAGCTAACGGTGAAGCAGTTGCGAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	84.466	98.095	0.829
comGC	Staphylococcus aureus MW2	84.466	98.095	0.829
comGC/cglC	Streptococcus pneumoniae R6	46.078	97.143	0.448
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	97.143	0.448
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	97.143	0.448
comGC/cglC	Streptococcus pneumoniae D39	46.078	97.143	0.448
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	81.905	0.419
comGC/cglC	Streptococcus mitis SK321	51.163	81.905	0.419
comGC	Lactococcus lactis subsp. cremoris KW2	51.899	75.238	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.067	84.762	0.39
comYC	Streptococcus mutans UA159	45.455	83.81	0.381
comYC	Streptococcus mutans UA140	45.455	83.81	0.381
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.304	87.619	0.362