NTDB

Overview

Name	pilA	Type	Machinery gene
Locus tag	PCP72_RS18050	Genome accession	NZ_CP115239
Coordinates	3819719..3820183 (-)	Length	154 a.a.
NCBI ID	WP_003107295.1	Uniprot ID	Q59794
Organism	Pseudomonas aeruginosa strain F045
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3814719..3825183

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PCP72_RS18035 (PCP72_18015)	nadC	3817240..3818088 (+)	849	WP_003116246.1	carboxylating nicotinate-nucleotide diphosphorylase	-
PCP72_RS18045 (PCP72_18025)	-	3818269..3819627 (-)	1359	WP_225319414.1	O-antigen ligase family protein	-
PCP72_RS18050 (PCP72_18030)	pilA	3819719..3820183 (-)	465	WP_003107295.1	pilin	Machinery gene
PCP72_RS18055 (PCP72_18035)	pilB	3820414..3822114 (+)	1701	WP_023084853.1	type IV-A pilus assembly ATPase PilB	Machinery gene
PCP72_RS18060 (PCP72_18040)	pilC	3822118..3823335 (+)	1218	WP_003107299.1	type II secretion system F family protein	Machinery gene
PCP72_RS18065 (PCP72_18045)	pilD	3823336..3824208 (+)	873	WP_023084852.1	type IV prepilin peptidase/methyltransferase PilD	Machinery gene
PCP72_RS18070 (PCP72_18050)	coaE	3824205..3824816 (+)	612	WP_003094654.1	dephospho-CoA kinase	-
PCP72_RS18075 (PCP72_18055)	yacG	3824813..3825013 (+)	201	WP_003094656.1	DNA gyrase inhibitor YacG	-

Sequence

Protein

Download Length: 154 a.a. Molecular weight: 16316.75 Da Isoelectric Point: 9.0066

                                >NTDB_id=697996 PCP72_RS18050 WP_003107295.1 3819719..3820183(-) (pilA) [Pseudomonas aeruginosa strain F045]

MKAQKGFTLIELMIVVAIIGILAAIAIPQYQDYTARTQVTRAVSEVSALKTAAESAILEGKEIVSTKTPNDTQYDIGFTE

STLLDLKGKEQIKVTDNKNGTVQLVATLGGSSGSAIKGAVITVSRDAQGVWSCNITKTPTAWKPNYAPANCPKS

Nucleotide

Download Length: 465 bp

                                >NTDB_id=697996 PCP72_RS18050 WP_003107295.1 3819719..3820183(-) (pilA) [Pseudomonas aeruginosa strain F045]

ATGAAAGCTCAGAAGGGTTTTACTCTGATCGAACTGATGATCGTGGTCGCGATCATCGGCATCCTGGCCGCCATTGCCAT

CCCGCAATACCAGGACTACACCGCTCGTACCCAGGTGACCCGTGCCGTGAGTGAAGTCAGCGCGCTGAAGACCGCTGCGG

AGTCGGCGATTCTGGAAGGGAAGGAGATTGTTTCCACCAAGACTCCTAACGATACCCAGTATGACATTGGCTTTACTGAA

TCTACTTTGCTGGATCTCAAGGGTAAAGAACAGATTAAAGTTACGGATAATAAAAATGGTACCGTGCAGCTAGTTGCTAC

TCTGGGTGGTTCTTCTGGTTCCGCCATCAAAGGAGCTGTCATCACTGTTTCGCGTGACGCTCAAGGAGTCTGGAGCTGCA

ATATCACCAAAACTCCTACAGCTTGGAAGCCCAACTACGCTCCGGCTAATTGCCCGAAATCCTAA

Domains

Predicted by InterProScan.

Pilin (bacterial filament) (Pilin)

(35-151)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q59794

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA	Pseudomonas aeruginosa PAK	43.312	100	0.442
pilA/pilAI	Pseudomonas stutzeri DSM 10701	44.444	99.351	0.442
pilA	Acinetobacter baumannii strain A118	44.079	98.701	0.435
comP	Acinetobacter baylyi ADP1	38.415	100	0.409
pilA	Ralstonia pseudosolanacearum GMI1000	33.708	100	0.39
pilA	Vibrio parahaemolyticus RIMD 2210633	39.333	97.403	0.383
pilA/pilAII	Pseudomonas stutzeri DSM 10701	37.419	100	0.377
pilA	Vibrio cholerae strain A1552	36.129	100	0.364
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	36.129	100	0.364
pilA	Vibrio cholerae C6706	36.129	100	0.364
pilE	Neisseria gonorrhoeae MS11	41.791	87.013	0.364

Detailed information NTG0697996