NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	M5C73_RS11635	Genome accession	NZ_CP098790
Coordinates	2329528..2329911 (-)	Length	127 a.a.
NCBI ID	WP_080735951.1	Uniprot ID	-
Organism	Lactococcus lactis strain WiKim0124
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2324528..2334911

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
M5C73_RS11595 (M5C73_11595)	-	2325064..2325873 (-)	810	WP_014570791.1	metal ABC transporter permease	-
M5C73_RS11600 (M5C73_11600)	-	2325866..2326603 (-)	738	WP_012898617.1	metal ABC transporter ATP-binding protein	-
M5C73_RS11605 (M5C73_11605)	-	2326780..2327622 (-)	843	WP_015427160.1	metal ABC transporter substrate-binding protein	-
M5C73_RS11610 (M5C73_11610)	-	2327619..2328056 (-)	438	WP_010906313.1	zinc-dependent MarR family transcriptional regulator	-
M5C73_RS11615 (M5C73_11615)	comGG	2328137..2328421 (-)	285	WP_017865155.1	competence type IV pilus minor pilin ComGG	Machinery gene
M5C73_RS11620 (M5C73_11620)	comGF	2328460..2328885 (-)	426	WP_161935022.1	competence type IV pilus minor pilin ComGF	Machinery gene
M5C73_RS11625 (M5C73_11625)	comGE	2328869..2329165 (-)	297	WP_250354455.1	competence type IV pilus minor pilin ComGE	Machinery gene
M5C73_RS11630 (M5C73_11630)	comGD	2329137..2329553 (-)	417	WP_032941843.1	competence type IV pilus minor pilin ComGD	Machinery gene
M5C73_RS11635 (M5C73_11635)	comGC	2329528..2329911 (-)	384	WP_080735951.1	competence type IV pilus major pilin ComGC	Machinery gene
M5C73_RS11640 (M5C73_11640)	comGB	2329925..2330944 (-)	1020	WP_047206974.1	competence type IV pilus assembly protein ComGB	Machinery gene
M5C73_RS11645 (M5C73_11645)	comGA	2330892..2331830 (-)	939	WP_058203709.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

Download Length: 127 a.a. Molecular weight: 14839.44 Da Isoelectric Point: 8.4563

                                >NTDB_id=697994 M5C73_RS11635 WP_080735951.1 2329528..2329911(-) (comGC) [Lactococcus lactis strain WiKim0124]

MERTKKFILKKIQKIFLFVKICEKKCRQKELRAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQA

QLYELDHDDEKPTLSELLSAGMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

Download Length: 384 bp

                                >NTDB_id=697994 M5C73_RS11635 WP_080735951.1 2329528..2329911(-) (comGC) [Lactococcus lactis strain WiKim0124]

ATGGAAAGAACTAAGAAGTTTATTTTAAAGAAAATACAAAAAATATTTTTATTCGTTAAAATTTGTGAAAAAAAATGCCG

TCAGAAAGAGCTAAGAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTG

TTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTGAAAGTAGTAGAAAGTCAAGCC

CAACTTTATGAATTAGATCATGATGATGAGAAGCCGACTCTGTCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACA

AATTTCTGCTTACGATAATTACTATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(32-52)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Lactococcus lactis subsp. cremoris KW2	80.172	91.339	0.732
comYC	Streptococcus mutans UA159	57.426	79.528	0.457
comYC	Streptococcus mutans UA140	57.426	79.528	0.457
comYC	Streptococcus gordonii str. Challis substr. CH1	56.566	77.953	0.441
comGC/cglC	Streptococcus mitis SK321	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	52.475	79.528	0.417
comGC/cglC	Streptococcus pneumoniae Rx1	52.475	79.528	0.417
comGC/cglC	Streptococcus pneumoniae D39	52.475	79.528	0.417
comGC/cglC	Streptococcus pneumoniae R6	52.475	79.528	0.417
comGC/cglC	Streptococcus mitis NCTC 12261	56.18	70.079	0.394
comYC	Streptococcus suis isolate S10	56.818	69.291	0.394

Detailed information NTG0697994