Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | M9H69_RS00215 | Genome accession | NZ_CP097843 |
| Coordinates | 33210..33602 (+) | Length | 130 a.a. |
| NCBI ID | WP_007518739.1 | Uniprot ID | A0A4V0BNW3 |
| Organism | Streptococcus oralis strain HP01 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12173..68268 | 33210..33602 | within | 0 |
Gene organization within MGE regions
Location: 12173..68268
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9H69_RS00060 (M9H69_00060) | ftsH | 12173..14131 (+) | 1959 | WP_084874658.1 | ATP-dependent zinc metalloprotease FtsH | - |
| M9H69_RS00065 (M9H69_00065) | - | 14186..14431 (+) | 246 | Protein_13 | 23S rRNA (uracil-5-)-methyltransferase RumA | - |
| M9H69_RS00100 (M9H69_00100) | - | 19915..20850 (+) | 936 | WP_009729550.1 | IS30 family transposase | - |
| M9H69_RS00105 (M9H69_00105) | comW | 21053..21289 (+) | 237 | WP_000939506.1 | sigma(X)-activator ComW | - |
| M9H69_RS00110 (M9H69_00110) | - | 21532..22818 (+) | 1287 | WP_195217196.1 | adenylosuccinate synthase | - |
| M9H69_RS00115 (M9H69_00115) | tadA | 23019..23486 (+) | 468 | WP_250315586.1 | tRNA adenosine(34) deaminase TadA | - |
| M9H69_RS00125 (M9H69_00125) | - | 23695..24831 (-) | 1137 | WP_250315587.1 | site-specific integrase | - |
| M9H69_RS00130 (M9H69_00130) | - | 24956..25627 (-) | 672 | WP_250315588.1 | zinc ribbon domain-containing protein | - |
| M9H69_RS00135 (M9H69_00135) | - | 25760..26518 (-) | 759 | WP_250315589.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M9H69_RS00140 (M9H69_00140) | - | 26521..26904 (-) | 384 | WP_007518712.1 | helix-turn-helix transcriptional regulator | - |
| M9H69_RS00145 (M9H69_00145) | - | 27202..27393 (+) | 192 | WP_001112860.1 | DNA-binding protein | - |
| M9H69_RS00150 (M9H69_00150) | - | 27468..27740 (+) | 273 | WP_007518714.1 | hypothetical protein | - |
| M9H69_RS00155 (M9H69_00155) | - | 27737..27910 (+) | 174 | WP_250315590.1 | hypothetical protein | - |
| M9H69_RS00160 (M9H69_00160) | - | 27915..28172 (+) | 258 | WP_250315591.1 | hypothetical protein | - |
| M9H69_RS00165 (M9H69_00165) | - | 28183..28461 (+) | 279 | WP_250315592.1 | hypothetical protein | - |
| M9H69_RS00170 (M9H69_00170) | - | 28463..28693 (+) | 231 | WP_000252079.1 | hypothetical protein | - |
| M9H69_RS00175 (M9H69_00175) | - | 28707..29429 (+) | 723 | WP_250315593.1 | HNH endonuclease signature motif containing protein | - |
| M9H69_RS00180 (M9H69_00180) | - | 29422..29904 (+) | 483 | WP_250315594.1 | siphovirus Gp157 family protein | - |
| M9H69_RS00185 (M9H69_00185) | - | 29913..30263 (+) | 351 | WP_224757118.1 | hypothetical protein | - |
| M9H69_RS00190 (M9H69_00190) | - | 30263..30727 (+) | 465 | WP_049493537.1 | hypothetical protein | - |
| M9H69_RS00195 (M9H69_00195) | - | 30696..31871 (+) | 1176 | WP_250315595.1 | DEAD/DEAH box helicase family protein | - |
| M9H69_RS00200 (M9H69_00200) | - | 31883..32197 (+) | 315 | WP_250315596.1 | hypothetical protein | - |
| M9H69_RS00205 (M9H69_00205) | - | 32210..32920 (+) | 711 | WP_250315597.1 | ERF family protein | - |
| M9H69_RS00210 (M9H69_00210) | - | 32920..33210 (+) | 291 | WP_007518737.1 | hypothetical protein | - |
| M9H69_RS00215 (M9H69_00215) | ssbA | 33210..33602 (+) | 393 | WP_007518739.1 | single-stranded DNA-binding protein | Machinery gene |
| M9H69_RS00220 (M9H69_00220) | - | 33614..34441 (+) | 828 | WP_007518741.1 | bifunctional DNA primase/polymerase | - |
| M9H69_RS00225 (M9H69_00225) | - | 34425..35825 (+) | 1401 | WP_250315598.1 | virulence-associated E family protein | - |
| M9H69_RS00230 (M9H69_00230) | - | 36205..36357 (+) | 153 | WP_007518745.1 | hypothetical protein | - |
| M9H69_RS00235 (M9H69_00235) | - | 36357..36617 (+) | 261 | WP_007518746.1 | hypothetical protein | - |
| M9H69_RS00240 (M9H69_00240) | - | 36614..36766 (+) | 153 | WP_250315599.1 | hypothetical protein | - |
| M9H69_RS00245 (M9H69_00245) | - | 36779..37018 (+) | 240 | WP_250315600.1 | DUF1372 family protein | - |
| M9H69_RS00250 (M9H69_00250) | - | 37015..37515 (+) | 501 | WP_250315601.1 | MazG-like family protein | - |
| M9H69_RS00255 (M9H69_00255) | - | 37517..37795 (+) | 279 | WP_007518749.1 | hypothetical protein | - |
| M9H69_RS00260 (M9H69_00260) | - | 38208..38633 (+) | 426 | WP_250315602.1 | DUF1492 domain-containing protein | - |
| M9H69_RS00265 (M9H69_00265) | - | 38722..39249 (+) | 528 | WP_250315603.1 | terminase small subunit | - |
| M9H69_RS00270 (M9H69_00270) | - | 39233..40573 (+) | 1341 | WP_250315604.1 | terminase | - |
| M9H69_RS00275 (M9H69_00275) | - | 40584..42143 (+) | 1560 | WP_250315605.1 | capsid protein | - |
| M9H69_RS00280 (M9H69_00280) | - | 42100..42288 (+) | 189 | WP_007518758.1 | hypothetical protein | - |
| M9H69_RS00285 (M9H69_00285) | - | 42278..44047 (+) | 1770 | WP_250315606.1 | phage minor capsid protein | - |
| M9H69_RS00290 (M9H69_00290) | - | 44050..44307 (+) | 258 | WP_007518762.1 | hypothetical protein | - |
| M9H69_RS00295 (M9H69_00295) | - | 44361..44612 (+) | 252 | WP_007518764.1 | hypothetical protein | - |
| M9H69_RS00300 (M9H69_00300) | - | 44614..44865 (+) | 252 | WP_250315607.1 | DUF6275 family protein | - |
| M9H69_RS00305 (M9H69_00305) | - | 45080..45670 (+) | 591 | WP_250315608.1 | hypothetical protein | - |
| M9H69_RS00310 (M9H69_00310) | - | 45690..46589 (+) | 900 | WP_250315609.1 | capsid protein | - |
| M9H69_RS00315 (M9H69_00315) | - | 46608..46823 (+) | 216 | WP_250315610.1 | hypothetical protein | - |
| M9H69_RS00320 (M9H69_00320) | - | 46829..47203 (+) | 375 | WP_007518773.1 | hypothetical protein | - |
| M9H69_RS00325 (M9H69_00325) | - | 47203..47541 (+) | 339 | WP_138099583.1 | hypothetical protein | - |
| M9H69_RS00330 (M9H69_00330) | - | 47546..47926 (+) | 381 | WP_138099584.1 | hypothetical protein | - |
| M9H69_RS00335 (M9H69_00335) | - | 47929..48333 (+) | 405 | WP_250315611.1 | minor capsid protein | - |
| M9H69_RS00340 (M9H69_00340) | - | 48333..48776 (+) | 444 | WP_007518781.1 | hypothetical protein | - |
| M9H69_RS00345 (M9H69_00345) | - | 48818..49015 (+) | 198 | WP_195217141.1 | hypothetical protein | - |
| M9H69_RS00350 (M9H69_00350) | - | 49015..49317 (+) | 303 | WP_250315612.1 | hypothetical protein | - |
| M9H69_RS00355 (M9H69_00355) | - | 49352..49645 (+) | 294 | WP_029680951.1 | Gp15 family bacteriophage protein | - |
| M9H69_RS00360 (M9H69_00360) | - | 49659..52835 (+) | 3177 | WP_250315613.1 | hypothetical protein | - |
| M9H69_RS00365 (M9H69_00365) | - | 52845..53186 (+) | 342 | WP_049479251.1 | hypothetical protein | - |
| M9H69_RS00370 (M9H69_00370) | - | 53195..55930 (+) | 2736 | WP_250315614.1 | collagen-like protein | - |
| M9H69_RS00375 (M9H69_00375) | - | 55941..57989 (+) | 2049 | WP_250315615.1 | DUF859 family phage minor structural protein | - |
| M9H69_RS00380 (M9H69_00380) | - | 57999..58604 (+) | 606 | WP_250315616.1 | DUF1366 domain-containing protein | - |
| M9H69_RS00385 (M9H69_00385) | - | 58616..58915 (+) | 300 | WP_001810279.1 | hypothetical protein | - |
| M9H69_RS00390 (M9H69_00390) | - | 58919..59251 (+) | 333 | WP_061864867.1 | phage holin | - |
| M9H69_RS00395 (M9H69_00395) | - | 59254..60219 (+) | 966 | WP_250315617.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| M9H69_RS00400 (M9H69_00400) | - | 60504..60947 (+) | 444 | WP_250315618.1 | dUTP diphosphatase | - |
| M9H69_RS00405 (M9H69_00405) | - | 60949..61464 (+) | 516 | WP_250315619.1 | histidine phosphatase family protein | - |
| M9H69_RS00410 (M9H69_00410) | radA | 61475..62839 (+) | 1365 | WP_284453902.1 | DNA repair protein RadA | Machinery gene |
| M9H69_RS00415 (M9H69_00415) | - | 62912..63406 (+) | 495 | WP_002876632.1 | carbonic anhydrase | - |
| M9H69_RS00420 (M9H69_00420) | - | 63620..64588 (+) | 969 | WP_000010175.1 | ribose-phosphate diphosphokinase | - |
| M9H69_RS00425 (M9H69_00425) | - | 64708..65145 (+) | 438 | WP_250315621.1 | CoA-binding protein | - |
| M9H69_RS00430 (M9H69_00430) | - | 65173..66183 (-) | 1011 | WP_250315622.1 | YeiH family protein | - |
| M9H69_RS00435 (M9H69_00435) | - | 66332..67501 (+) | 1170 | WP_000366366.1 | pyridoxal phosphate-dependent aminotransferase | - |
| M9H69_RS00440 (M9H69_00440) | recO | 67498..68268 (+) | 771 | WP_084938702.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14825.44 Da Isoelectric Point: 4.6460
>NTDB_id=692892 M9H69_RS00215 WP_007518739.1 33210..33602(+) (ssbA) [Streptococcus oralis strain HP01]
MINNAVLVGRMTRDAELRYTPQNVAVATFTLAVNRTFKSQNGEREADFINCVMWRQQAENLANWAKKGSLIGVTGRIQTR
SYDNQQGQRVYVTEVVAENFQMLESRNQQSSNDTFGNDNPMDIQDDDLPF
MINNAVLVGRMTRDAELRYTPQNVAVATFTLAVNRTFKSQNGEREADFINCVMWRQQAENLANWAKKGSLIGVTGRIQTR
SYDNQQGQRVYVTEVVAENFQMLESRNQQSSNDTFGNDNPMDIQDDDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=692892 M9H69_RS00215 WP_007518739.1 33210..33602(+) (ssbA) [Streptococcus oralis strain HP01]
ATGATTAACAATGCTGTACTTGTAGGGCGCATGACCCGTGATGCTGAACTCCGCTATACACCGCAAAATGTAGCAGTTGC
GACTTTTACTCTTGCAGTAAACCGTACATTCAAGAGTCAAAATGGCGAACGCGAGGCTGACTTTATCAACTGCGTTATGT
GGCGCCAACAAGCCGAAAATCTTGCAAACTGGGCTAAAAAAGGCTCACTTATCGGGGTGACAGGCCGTATTCAGACTCGT
AGTTACGATAACCAGCAAGGACAACGTGTCTACGTGACAGAAGTCGTGGCTGAGAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAAAGTTCGAATGATACATTTGGGAATGACAACCCGATGGATATTCAAGACGACGATTTACCATTCTAA
ATGATTAACAATGCTGTACTTGTAGGGCGCATGACCCGTGATGCTGAACTCCGCTATACACCGCAAAATGTAGCAGTTGC
GACTTTTACTCTTGCAGTAAACCGTACATTCAAGAGTCAAAATGGCGAACGCGAGGCTGACTTTATCAACTGCGTTATGT
GGCGCCAACAAGCCGAAAATCTTGCAAACTGGGCTAAAAAAGGCTCACTTATCGGGGTGACAGGCCGTATTCAGACTCGT
AGTTACGATAACCAGCAAGGACAACGTGTCTACGTGACAGAAGTCGTGGCTGAGAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAAAGTTCGAATGATACATTTGGGAATGACAACCCGATGGATATTCAAGACGACGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.723 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.677 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.212 |
100 |
0.469 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.212 |
100 |
0.469 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.455 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.455 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.455 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.455 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.455 |
100 |
0.462 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.097 |
86.923 |
0.462 |
| ssbA | Streptococcus mutans UA159 |
41.667 |
100 |
0.423 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
46.667 |
80.769 |
0.377 |