Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | M2911_RS08730 | Genome accession | NZ_CP097038 |
| Coordinates | 1804538..1804813 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain AT39 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1768107..1804514 | 1804538..1804813 | flank | 24 |
Gene organization within MGE regions
Location: 1768107..1804813
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2911_RS08490 (M2911_08490) | - | 1768107..1769114 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| M2911_RS08495 (M2911_08495) | comGG | 1769243..1769596 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| M2911_RS08500 (M2911_08500) | comGF | 1769596..1770030 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| M2911_RS08505 (M2911_08505) | - | 1770020..1770391 (-) | 372 | WP_172351944.1 | type II secretion system protein | - |
| M2911_RS08510 (M2911_08510) | - | 1770542..1771627 (-) | 1086 | WP_105194863.1 | SH3 domain-containing protein | - |
| M2911_RS08515 (M2911_08515) | - | 1771669..1771875 (-) | 207 | WP_002395769.1 | BhlA/UviB family holin-like peptide | - |
| M2911_RS08520 (M2911_08520) | - | 1771901..1773118 (-) | 1218 | WP_129992381.1 | glycerophosphodiester phosphodiesterase | - |
| M2911_RS08525 (M2911_08525) | - | 1773118..1773405 (-) | 288 | WP_129992380.1 | collagen-like protein | - |
| M2911_RS08530 (M2911_08530) | - | 1773402..1773998 (-) | 597 | WP_129992379.1 | hypothetical protein | - |
| M2911_RS08535 (M2911_08535) | - | 1773991..1774905 (-) | 915 | WP_174082099.1 | phage baseplate upper protein | - |
| M2911_RS08540 (M2911_08540) | - | 1774924..1777761 (-) | 2838 | WP_105194774.1 | phage tail tip lysozyme | - |
| M2911_RS08545 (M2911_08545) | - | 1777758..1778462 (-) | 705 | WP_010826698.1 | hypothetical protein | - |
| M2911_RS08550 (M2911_08550) | - | 1778465..1780762 (-) | 2298 | WP_129992407.1 | phage tail tape measure protein | - |
| M2911_RS08555 (M2911_08555) | - | 1780954..1781409 (-) | 456 | WP_002395308.1 | hypothetical protein | - |
| M2911_RS08560 (M2911_08560) | - | 1781409..1782056 (-) | 648 | WP_105194772.1 | phage tail protein | - |
| M2911_RS08565 (M2911_08565) | - | 1782053..1782415 (-) | 363 | WP_105194771.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M2911_RS08570 (M2911_08570) | - | 1782405..1782743 (-) | 339 | WP_002398474.1 | hypothetical protein | - |
| M2911_RS08575 (M2911_08575) | - | 1782733..1783059 (-) | 327 | WP_002373974.1 | phage head closure protein | - |
| M2911_RS08580 (M2911_08580) | - | 1783037..1783318 (-) | 282 | WP_002395304.1 | phage gp6-like head-tail connector protein | - |
| M2911_RS08585 (M2911_08585) | - | 1783321..1784682 (-) | 1362 | WP_105194770.1 | phage major capsid protein | - |
| M2911_RS08590 (M2911_08590) | - | 1784694..1785266 (-) | 573 | WP_002393031.1 | HK97 family phage prohead protease | - |
| M2911_RS08595 (M2911_08595) | - | 1785253..1786464 (-) | 1212 | WP_029736326.1 | phage portal protein | - |
| M2911_RS08600 (M2911_08600) | - | 1786483..1788210 (-) | 1728 | WP_105194769.1 | terminase TerL endonuclease subunit | - |
| M2911_RS08605 (M2911_08605) | - | 1788207..1788659 (-) | 453 | WP_064687382.1 | P27 family phage terminase small subunit | - |
| M2911_RS08610 (M2911_08610) | - | 1788772..1789140 (-) | 369 | WP_002393035.1 | HNH endonuclease signature motif containing protein | - |
| M2911_RS08615 (M2911_08615) | - | 1789140..1789541 (-) | 402 | WP_104874806.1 | hypothetical protein | - |
| M2911_RS08620 (M2911_08620) | - | 1790006..1790422 (-) | 417 | WP_248881981.1 | sigma-70 family RNA polymerase sigma factor | - |
| M2911_RS08625 (M2911_08625) | - | 1790730..1792583 (-) | 1854 | WP_105194767.1 | phage/plasmid primase, P4 family | - |
| M2911_RS08630 (M2911_08630) | - | 1792638..1793411 (+) | 774 | WP_105194766.1 | DUF4145 domain-containing protein | - |
| M2911_RS08635 (M2911_08635) | - | 1793408..1794970 (-) | 1563 | WP_248881983.1 | hypothetical protein | - |
| M2911_RS08640 (M2911_08640) | - | 1794994..1795506 (-) | 513 | WP_248881985.1 | hypothetical protein | - |
| M2911_RS08645 (M2911_08645) | - | 1795557..1796477 (-) | 921 | WP_248881986.1 | AAA family ATPase | - |
| M2911_RS08650 (M2911_08650) | - | 1796480..1796680 (-) | 201 | WP_057086713.1 | hypothetical protein | - |
| M2911_RS08655 (M2911_08655) | - | 1796677..1796895 (-) | 219 | WP_104870337.1 | hypothetical protein | - |
| M2911_RS08660 (M2911_08660) | - | 1796897..1797808 (-) | 912 | WP_105194763.1 | YqaJ viral recombinase family protein | - |
| M2911_RS08665 (M2911_08665) | - | 1797821..1798063 (-) | 243 | WP_010826713.1 | hypothetical protein | - |
| M2911_RS08670 (M2911_08670) | - | 1798065..1799261 (-) | 1197 | WP_016626781.1 | DEAD/DEAH box helicase | - |
| M2911_RS08675 (M2911_08675) | - | 1799251..1799544 (-) | 294 | WP_010826715.1 | VRR-NUC domain-containing protein | - |
| M2911_RS08680 (M2911_08680) | - | 1799541..1799741 (-) | 201 | WP_105194762.1 | hypothetical protein | - |
| M2911_RS08685 (M2911_08685) | - | 1799956..1800255 (-) | 300 | WP_248881988.1 | hypothetical protein | - |
| M2911_RS08690 (M2911_08690) | - | 1800373..1800552 (-) | 180 | WP_002395800.1 | hypothetical protein | - |
| M2911_RS08695 (M2911_08695) | - | 1800559..1800870 (-) | 312 | WP_105194760.1 | hypothetical protein | - |
| M2911_RS08700 (M2911_08700) | - | 1800881..1801057 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| M2911_RS08705 (M2911_08705) | - | 1801369..1801701 (+) | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | - |
| M2911_RS08710 (M2911_08710) | - | 1801719..1802063 (+) | 345 | WP_105194759.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M2911_RS08715 (M2911_08715) | - | 1802097..1802825 (+) | 729 | WP_033918699.1 | potassium channel family protein | - |
| M2911_RS08720 (M2911_08720) | - | 1802922..1804070 (+) | 1149 | WP_105194837.1 | site-specific integrase | - |
| M2911_RS08725 (M2911_08725) | comGD | 1804098..1804541 (-) | 444 | WP_248881990.1 | competence type IV pilus minor pilin ComGD | - |
| M2911_RS08730 (M2911_08730) | comGC/cglC | 1804538..1804813 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=686482 M2911_RS08730 WP_002356991.1 1804538..1804813(-) (comGC/cglC) [Enterococcus faecalis strain AT39]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=686482 M2911_RS08730 WP_002356991.1 1804538..1804813(-) (comGC/cglC) [Enterococcus faecalis strain AT39]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |