Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | M2925_RS08075 | Genome accession | NZ_CP097004 |
| Coordinates | 1678751..1679026 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain LS05-2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1673751..1684026
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2925_RS08040 (M2925_08040) | - | 1674306..1674779 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| M2925_RS08045 (M2925_08045) | - | 1674891..1676078 (-) | 1188 | WP_002357064.1 | acetate kinase | - |
| M2925_RS08050 (M2925_08050) | - | 1676103..1677110 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| M2925_RS08055 (M2925_08055) | comGG | 1677239..1677592 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| M2925_RS08060 (M2925_08060) | comGF | 1677592..1678026 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| M2925_RS08065 (M2925_08065) | - | 1678016..1678342 (-) | 327 | WP_085454834.1 | type II secretion system protein | - |
| M2925_RS08070 (M2925_08070) | comGD | 1678308..1678754 (-) | 447 | WP_002379576.1 | competence type IV pilus minor pilin ComGD | - |
| M2925_RS08075 (M2925_08075) | comGC/cglC | 1678751..1679026 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| M2925_RS08080 (M2925_08080) | comGB | 1679026..1680072 (-) | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| M2925_RS08085 (M2925_08085) | comGA | 1680029..1680997 (-) | 969 | WP_002374519.1 | competence type IV pilus ATPase ComGA | - |
| M2925_RS08090 (M2925_08090) | - | 1681241..1682569 (-) | 1329 | WP_010816624.1 | amino acid permease | - |
| M2925_RS08095 (M2925_08095) | rlmN | 1682860..1683933 (-) | 1074 | WP_219259363.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=686048 M2925_RS08075 WP_002356991.1 1678751..1679026(-) (comGC/cglC) [Enterococcus faecalis strain LS05-2]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=686048 M2925_RS08075 WP_002356991.1 1678751..1679026(-) (comGC/cglC) [Enterococcus faecalis strain LS05-2]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |