Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | M2926_RS07765 | Genome accession | NZ_CP097002 |
| Coordinates | 1624400..1624675 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain LS06-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1619400..1629675
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2926_RS07725 (M2926_07725) | - | 1619445..1619777 (+) | 333 | WP_002357068.1 | hypothetical protein | - |
| M2926_RS07730 (M2926_07730) | - | 1619955..1620428 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| M2926_RS07735 (M2926_07735) | - | 1620540..1621727 (-) | 1188 | WP_002357064.1 | acetate kinase | - |
| M2926_RS07740 (M2926_07740) | - | 1621752..1622759 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| M2926_RS07745 (M2926_07745) | comGG | 1622888..1623241 (-) | 354 | WP_016618446.1 | competence type IV pilus minor pilin ComGG | - |
| M2926_RS07750 (M2926_07750) | comGF | 1623241..1623675 (-) | 435 | WP_010707381.1 | competence type IV pilus minor pilin ComGF | - |
| M2926_RS07755 (M2926_07755) | - | 1623665..1623991 (-) | 327 | WP_010775953.1 | type II secretion system protein | - |
| M2926_RS07760 (M2926_07760) | comGD | 1623957..1624403 (-) | 447 | WP_033625038.1 | competence type IV pilus minor pilin ComGD | - |
| M2926_RS07765 (M2926_07765) | comGC/cglC | 1624400..1624675 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| M2926_RS07770 (M2926_07770) | comGB | 1624675..1625721 (-) | 1047 | WP_142960931.1 | competence type IV pilus assembly protein ComGB | - |
| M2926_RS07775 (M2926_07775) | comGA | 1625678..1626646 (-) | 969 | WP_142960930.1 | competence type IV pilus ATPase ComGA | - |
| M2926_RS07780 (M2926_07780) | - | 1626886..1628214 (-) | 1329 | WP_071981488.1 | amino acid permease | - |
| M2926_RS07785 (M2926_07785) | rlmN | 1628505..1629578 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=686012 M2926_RS07765 WP_002356991.1 1624400..1624675(-) (comGC/cglC) [Enterococcus faecalis strain LS06-1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=686012 M2926_RS07765 WP_002356991.1 1624400..1624675(-) (comGC/cglC) [Enterococcus faecalis strain LS06-1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |