Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | EFW11_RS08470 | Genome accession | NZ_AP017623 |
| Coordinates | 1679168..1679443 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain W11 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1674168..1684443
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EFW11_RS08425 (EFW11_1583) | - | 1674267..1674545 (+) | 279 | WP_002380425.1 | hypothetical protein | - |
| EFW11_RS08435 (EFW11_1584) | - | 1674723..1675196 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| EFW11_RS08440 (EFW11_1585) | - | 1675308..1676495 (-) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| EFW11_RS08445 (EFW11_1586) | - | 1676520..1677527 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| EFW11_RS08450 (EFW11_1587) | comGG | 1677656..1678009 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| EFW11_RS08455 (EFW11_1588) | comGF | 1678009..1678443 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| EFW11_RS08460 (EFW11_1589) | - | 1678433..1678759 (-) | 327 | WP_025189556.1 | type II secretion system protein | - |
| EFW11_RS08465 (EFW11_1590) | comGD | 1678725..1679171 (-) | 447 | WP_096397849.1 | competence type IV pilus minor pilin ComGD | - |
| EFW11_RS08470 (EFW11_1591) | comGC/cglC | 1679168..1679443 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| EFW11_RS08475 (EFW11_1592) | comGB | 1679443..1680489 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| EFW11_RS08480 (EFW11_1593) | comGA | 1680446..1681414 (-) | 969 | WP_096397850.1 | competence type IV pilus ATPase ComGA | - |
| EFW11_RS08485 (EFW11_1594) | - | 1681654..1682982 (-) | 1329 | WP_064687249.1 | APC family permease | - |
| EFW11_RS08490 (EFW11_1595) | rlmN | 1683273..1684346 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=68175 EFW11_RS08470 WP_002356991.1 1679168..1679443(-) (comGC/cglC) [Enterococcus faecalis strain W11]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=68175 EFW11_RS08470 WP_002356991.1 1679168..1679443(-) (comGC/cglC) [Enterococcus faecalis strain W11]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTATACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTATACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |