Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MU858_RS10915 | Genome accession | NZ_CP095874 |
| Coordinates | 2087120..2087455 (+) | Length | 111 a.a. |
| NCBI ID | WP_247998921.1 | Uniprot ID | A0A8T9ZI18 |
| Organism | Bacillus sp. PGP15 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2034111..2087455 | 2087120..2087455 | within | 0 |
Gene organization within MGE regions
Location: 2034111..2087455
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MU858_RS10595 (MU858_10595) | - | 2034111..2035250 (-) | 1140 | WP_247998909.1 | site-specific integrase | - |
| MU858_RS10600 (MU858_10600) | - | 2035271..2035789 (-) | 519 | WP_000487833.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MU858_RS10605 (MU858_10605) | - | 2036240..2036596 (-) | 357 | WP_000004574.1 | helix-turn-helix transcriptional regulator | - |
| MU858_RS10610 (MU858_10610) | - | 2036781..2036984 (+) | 204 | WP_000413421.1 | helix-turn-helix transcriptional regulator | - |
| MU858_RS10615 (MU858_10615) | - | 2037018..2037317 (+) | 300 | WP_000606752.1 | helix-turn-helix domain-containing protein | - |
| MU858_RS10620 (MU858_10620) | - | 2037385..2037900 (+) | 516 | WP_000022024.1 | helix-turn-helix transcriptional regulator | - |
| MU858_RS10625 (MU858_10625) | - | 2037931..2038152 (+) | 222 | WP_000151155.1 | hypothetical protein | - |
| MU858_RS10630 (MU858_10630) | - | 2038334..2038618 (+) | 285 | WP_000834161.1 | hypothetical protein | - |
| MU858_RS10635 (MU858_10635) | - | 2038736..2039721 (+) | 986 | Protein_2017 | DnaD domain protein | - |
| MU858_RS10640 (MU858_10640) | - | 2039732..2040094 (+) | 363 | WP_001125986.1 | hypothetical protein | - |
| MU858_RS10645 (MU858_10645) | - | 2040166..2040357 (+) | 192 | WP_000511363.1 | DUF3954 domain-containing protein | - |
| MU858_RS10650 (MU858_10650) | - | 2040425..2040835 (-) | 411 | WP_157409661.1 | S-Ena type endospore appendage | - |
| MU858_RS10655 (MU858_10655) | - | 2040928..2041260 (-) | 333 | WP_000332680.1 | S-Ena type endospore appendage | - |
| MU858_RS10660 (MU858_10660) | - | 2041472..2042026 (+) | 555 | WP_157409662.1 | hypothetical protein | - |
| MU858_RS10665 (MU858_10665) | - | 2042047..2042214 (+) | 168 | WP_167519253.1 | hypothetical protein | - |
| MU858_RS10670 (MU858_10670) | - | 2043697..2043945 (+) | 249 | WP_247998910.1 | helix-turn-helix transcriptional regulator | - |
| MU858_RS10675 (MU858_10675) | - | 2043967..2044137 (+) | 171 | WP_167519254.1 | hypothetical protein | - |
| MU858_RS10680 (MU858_10680) | - | 2044587..2045243 (+) | 657 | Protein_2026 | hypothetical protein | - |
| MU858_RS10685 (MU858_10685) | - | 2045403..2045573 (+) | 171 | WP_167519255.1 | hypothetical protein | - |
| MU858_RS10690 (MU858_10690) | - | 2045602..2046084 (+) | 483 | WP_017673837.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MU858_RS10695 (MU858_10695) | - | 2046084..2046626 (+) | 543 | WP_017673838.1 | site-specific integrase | - |
| MU858_RS10700 (MU858_10700) | - | 2046967..2047539 (+) | 573 | WP_000559141.1 | cupin domain-containing protein | - |
| MU858_RS10705 (MU858_10705) | - | 2047734..2048783 (+) | 1050 | WP_247998911.1 | endonuclease/exonuclease/phosphatase family protein | - |
| MU858_RS10710 (MU858_10710) | - | 2049097..2050029 (+) | 933 | WP_157409665.1 | hypothetical protein | - |
| MU858_RS10715 (MU858_10715) | - | 2050294..2050578 (+) | 285 | WP_048530288.1 | hypothetical protein | - |
| MU858_RS10720 (MU858_10720) | - | 2050985..2051128 (-) | 144 | WP_157409666.1 | DUF3956 family protein | - |
| MU858_RS10725 (MU858_10725) | - | 2051317..2051859 (+) | 543 | WP_000673901.1 | site-specific integrase | - |
| MU858_RS10730 (MU858_10730) | - | 2051931..2052110 (+) | 180 | WP_000390790.1 | hypothetical protein | - |
| MU858_RS10735 (MU858_10735) | terS | 2052132..2052980 (+) | 849 | WP_247998912.1 | phage terminase small subunit | - |
| MU858_RS10740 (MU858_10740) | - | 2052973..2054379 (+) | 1407 | WP_157409668.1 | DEAD/DEAH box helicase family protein | - |
| MU858_RS10745 (MU858_10745) | - | 2054449..2055927 (+) | 1479 | WP_157409669.1 | phage portal protein | - |
| MU858_RS10750 (MU858_10750) | - | 2056041..2056559 (+) | 519 | WP_157409670.1 | phage minor head protein | - |
| MU858_RS10755 (MU858_10755) | - | 2056673..2057875 (+) | 1203 | WP_157409671.1 | XkdF-like putative serine protease domain-containing protein | - |
| MU858_RS10760 (MU858_10760) | - | 2057893..2058879 (+) | 987 | WP_247998913.1 | phage major capsid protein | - |
| MU858_RS10765 (MU858_10765) | - | 2059049..2059213 (+) | 165 | WP_157409673.1 | YqbF domain-containing protein | - |
| MU858_RS10770 (MU858_10770) | - | 2059213..2059749 (+) | 537 | WP_247998914.1 | hypothetical protein | - |
| MU858_RS10775 (MU858_10775) | - | 2059746..2060114 (+) | 369 | WP_157409675.1 | hypothetical protein | - |
| MU858_RS10780 (MU858_10780) | - | 2060121..2060532 (+) | 412 | Protein_2046 | HK97 gp10 family phage protein | - |
| MU858_RS10785 (MU858_10785) | - | 2060537..2060959 (+) | 423 | WP_088119543.1 | hypothetical protein | - |
| MU858_RS10790 (MU858_10790) | - | 2060972..2061580 (+) | 609 | WP_157409676.1 | hypothetical protein | - |
| MU858_RS10795 (MU858_10795) | - | 2061638..2062168 (+) | 531 | WP_157409677.1 | hypothetical protein | - |
| MU858_RS10800 (MU858_10800) | - | 2062120..2062554 (+) | 435 | WP_157409678.1 | hypothetical protein | - |
| MU858_RS10805 (MU858_10805) | - | 2062589..2063521 (+) | 933 | Protein_2051 | phage tail tape measure protein | - |
| MU858_RS10810 (MU858_10810) | - | 2063744..2065750 (+) | 2007 | WP_247998916.1 | hypothetical protein | - |
| MU858_RS10815 (MU858_10815) | - | 2065747..2066430 (+) | 684 | WP_247998917.1 | hypothetical protein | - |
| MU858_RS10820 (MU858_10820) | - | 2066571..2067977 (+) | 1407 | WP_247998918.1 | hypothetical protein | - |
| MU858_RS10825 (MU858_10825) | - | 2067988..2068371 (+) | 384 | WP_157409683.1 | hypothetical protein | - |
| MU858_RS10830 (MU858_10830) | - | 2068416..2068790 (+) | 375 | WP_157409684.1 | Low copy number virion structural protein | - |
| MU858_RS10835 (MU858_10835) | - | 2068803..2069180 (+) | 378 | WP_157409685.1 | Low copy number virion structural protein | - |
| MU858_RS10840 (MU858_10840) | - | 2069194..2070534 (+) | 1341 | WP_157409686.1 | hypothetical protein | - |
| MU858_RS10845 (MU858_10845) | - | 2070549..2072276 (+) | 1728 | WP_157409687.1 | hypothetical protein | - |
| MU858_RS10850 (MU858_10850) | - | 2072300..2074570 (+) | 2271 | WP_157409688.1 | hypothetical protein | - |
| MU858_RS10855 (MU858_10855) | - | 2074552..2076108 (+) | 1557 | WP_247998919.1 | cell adhesion protein | - |
| MU858_RS10860 (MU858_10860) | - | 2076118..2076501 (+) | 384 | WP_157409690.1 | hypothetical protein | - |
| MU858_RS10865 (MU858_10865) | - | 2076515..2077435 (+) | 921 | WP_157409691.1 | hypothetical protein | - |
| MU858_RS10870 (MU858_10870) | - | 2077744..2078241 (+) | 498 | WP_157409692.1 | phage holin family protein | - |
| MU858_RS10875 (MU858_10875) | - | 2078320..2079378 (+) | 1059 | WP_247998920.1 | N-acetylmuramoyl-L-alanine amidase | - |
| MU858_RS10880 (MU858_10880) | - | 2079414..2079723 (-) | 310 | Protein_2066 | YolD-like family protein | - |
| MU858_RS10885 (MU858_10885) | - | 2079970..2081625 (+) | 1656 | WP_157409694.1 | multicopper oxidase | - |
| MU858_RS10890 (MU858_10890) | - | 2082206..2082994 (-) | 789 | WP_157409695.1 | hypothetical protein | - |
| MU858_RS10895 (MU858_10895) | - | 2083104..2083751 (+) | 648 | WP_157409696.1 | HD domain-containing protein | - |
| MU858_RS10900 (MU858_10900) | - | 2083748..2085643 (+) | 1896 | WP_157409697.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| MU858_RS10905 (MU858_10905) | - | 2085719..2086450 (+) | 732 | WP_001260655.1 | Bax inhibitor-1/YccA family protein | - |
| MU858_RS10910 (MU858_10910) | - | 2086556..2086810 (+) | 255 | WP_048528794.1 | DUF4318 domain-containing protein | - |
| MU858_RS10915 (MU858_10915) | ssbA | 2087120..2087455 (+) | 336 | WP_247998921.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 111 a.a. Molecular weight: 12808.63 Da Isoelectric Point: 9.0594
>NTDB_id=679002 MU858_RS10915 WP_247998921.1 2087120..2087455(+) (ssbA) [Bacillus sp. PGP15]
MMNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVIWRRSAENVTEYCTKGSLVGITGRIHTR
NYEDDQGKRIYVTEVVIENITYLEKRREGAS
MMNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVIWRRSAENVTEYCTKGSLVGITGRIHTR
NYEDDQGKRIYVTEVVIENITYLEKRREGAS
Nucleotide
Download Length: 336 bp
>NTDB_id=679002 MU858_RS10915 WP_247998921.1 2087120..2087455(+) (ssbA) [Bacillus sp. PGP15]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAGCAAGGCGTCGCGTATGC
ACGAGTATGTGTTGCTGTGAATAGAGGTTTTCGAAATAGTTTAGGTGAACAACAAGTAGATTTTATTAATTGCGTGATAT
GGAGAAGGTCAGCTGAGAATGTAACTGAATATTGTACGAAAGGTTCACTTGTTGGAATTACCGGACGTATTCATACGAGG
AATTACGAGGATGATCAAGGAAAGAGAATATATGTAACGGAAGTTGTGATTGAAAATATTACATATTTGGAGAAAAGGCG
GGAGGGTGCATCATAA
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAGCAAGGCGTCGCGTATGC
ACGAGTATGTGTTGCTGTGAATAGAGGTTTTCGAAATAGTTTAGGTGAACAACAAGTAGATTTTATTAATTGCGTGATAT
GGAGAAGGTCAGCTGAGAATGTAACTGAATATTGTACGAAAGGTTCACTTGTTGGAATTACCGGACGTATTCATACGAGG
AATTACGAGGATGATCAAGGAAAGAGAATATATGTAACGGAAGTTGTGATTGAAAATATTACATATTTGGAGAAAAGGCG
GGAGGGTGCATCATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
95.495 |
0.559 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.547 |
95.495 |
0.55 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
100 |
0.523 |
| ssbA | Streptococcus mutans UA159 |
44.545 |
99.099 |
0.441 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.545 |
99.099 |
0.441 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.545 |
99.099 |
0.441 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.636 |
99.099 |
0.432 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.636 |
99.099 |
0.432 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.636 |
99.099 |
0.432 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.636 |
99.099 |
0.432 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
44.762 |
94.595 |
0.423 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.727 |
99.099 |
0.423 |