Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MP619_RS04870 | Genome accession | NZ_CP095081 |
| Coordinates | 937841..938233 (+) | Length | 130 a.a. |
| NCBI ID | WP_155782953.1 | Uniprot ID | - |
| Organism | Streptococcus dysgalactiae strain WJ001 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 926698..971156 | 937841..938233 | within | 0 |
Gene organization within MGE regions
Location: 926698..971156
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MP619_RS04760 (MP619_04745) | - | 926698..927894 (-) | 1197 | WP_155782942.1 | site-specific integrase | - |
| MP619_RS04765 (MP619_04750) | - | 928205..928945 (-) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MP619_RS04770 (MP619_04755) | - | 928956..929348 (-) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MP619_RS04775 (MP619_04760) | - | 929352..929702 (-) | 351 | WP_011017353.1 | helix-turn-helix transcriptional regulator | - |
| MP619_RS04780 (MP619_04765) | - | 929997..930266 (+) | 270 | WP_268227868.1 | hypothetical protein | - |
| MP619_RS04785 (MP619_04770) | - | 930301..930513 (+) | 213 | WP_011054420.1 | helix-turn-helix transcriptional regulator | - |
| MP619_RS04790 | - | 930587..930721 (+) | 135 | WP_011017356.1 | hypothetical protein | - |
| MP619_RS04795 (MP619_04775) | - | 931394..932077 (+) | 684 | WP_268227869.1 | ORF6C domain-containing protein | - |
| MP619_RS04800 (MP619_04780) | - | 932101..932358 (+) | 258 | WP_011054421.1 | hypothetical protein | - |
| MP619_RS04805 (MP619_04785) | - | 932496..932693 (+) | 198 | WP_268227870.1 | hypothetical protein | - |
| MP619_RS04810 (MP619_04790) | - | 932696..933280 (+) | 585 | WP_155782944.1 | hypothetical protein | - |
| MP619_RS04815 (MP619_04795) | - | 933328..934239 (+) | 912 | WP_268227871.1 | DnaD domain protein | - |
| MP619_RS04820 (MP619_04800) | - | 934275..934514 (+) | 240 | WP_155782946.1 | hypothetical protein | - |
| MP619_RS04825 (MP619_04805) | - | 934524..934709 (+) | 186 | WP_155782947.1 | hypothetical protein | - |
| MP619_RS04830 (MP619_04810) | - | 934706..934891 (+) | 186 | WP_069107271.1 | hypothetical protein | - |
| MP619_RS04835 (MP619_04815) | - | 934923..935117 (+) | 195 | WP_231112816.1 | hypothetical protein | - |
| MP619_RS04840 (MP619_04820) | - | 935107..935886 (+) | 780 | WP_155782949.1 | DNA methyltransferase | - |
| MP619_RS04845 (MP619_04825) | - | 935910..936659 (+) | 750 | WP_136040185.1 | DNA methyltransferase | - |
| MP619_RS04850 (MP619_04830) | - | 936758..937027 (+) | 270 | Protein_905 | DUF1642 domain-containing protein | - |
| MP619_RS04855 (MP619_04835) | - | 937082..937306 (+) | 225 | Protein_906 | DUF3310 domain-containing protein | - |
| MP619_RS04860 (MP619_04840) | - | 937299..937631 (+) | 333 | WP_155782951.1 | hypothetical protein | - |
| MP619_RS04865 (MP619_04845) | - | 937624..937851 (+) | 228 | WP_155782952.1 | hypothetical protein | - |
| MP619_RS04870 (MP619_04850) | ssb | 937841..938233 (+) | 393 | WP_155782953.1 | single-stranded DNA-binding protein | Machinery gene |
| MP619_RS04875 (MP619_04855) | - | 938243..938578 (+) | 336 | WP_155782954.1 | hypothetical protein | - |
| MP619_RS04880 (MP619_04860) | - | 938595..938981 (+) | 387 | WP_155782955.1 | hypothetical protein | - |
| MP619_RS04885 (MP619_04865) | - | 939002..939523 (+) | 522 | WP_155782956.1 | hypothetical protein | - |
| MP619_RS04890 (MP619_04870) | - | 939520..939855 (+) | 336 | WP_268227872.1 | helix-turn-helix transcriptional regulator | - |
| MP619_RS04895 (MP619_04875) | - | 939978..940805 (+) | 828 | WP_155782958.1 | prohibitin family protein | - |
| MP619_RS04900 (MP619_04880) | - | 940820..941221 (+) | 402 | WP_155782959.1 | transcriptional regulator | - |
| MP619_RS04905 (MP619_04885) | - | 941381..941956 (+) | 576 | WP_029713968.1 | site-specific integrase | - |
| MP619_RS04910 (MP619_04890) | - | 942257..942643 (+) | 387 | WP_155782960.1 | hypothetical protein | - |
| MP619_RS04915 (MP619_04895) | - | 942636..942941 (+) | 306 | WP_065956789.1 | HNH endonuclease signature motif containing protein | - |
| MP619_RS04920 (MP619_04900) | - | 943085..943402 (+) | 318 | WP_015984806.1 | P27 family phage terminase small subunit | - |
| MP619_RS04925 (MP619_04905) | - | 943415..945145 (+) | 1731 | WP_155782961.1 | terminase large subunit | - |
| MP619_RS04930 (MP619_04910) | - | 945326..946513 (+) | 1188 | WP_155782962.1 | phage portal protein | - |
| MP619_RS04935 (MP619_04915) | - | 946494..947300 (+) | 807 | WP_155782963.1 | head maturation protease, ClpP-related | - |
| MP619_RS04940 (MP619_04920) | - | 947317..948450 (+) | 1134 | WP_155782964.1 | phage major capsid protein | - |
| MP619_RS04945 (MP619_04925) | - | 948464..948637 (+) | 174 | WP_196772220.1 | hypothetical protein | - |
| MP619_RS04950 (MP619_04930) | - | 948637..948942 (+) | 306 | WP_155782965.1 | hypothetical protein | - |
| MP619_RS04955 (MP619_04935) | - | 948935..949297 (+) | 363 | WP_155782966.1 | phage head-tail adapter protein | - |
| MP619_RS04960 (MP619_04940) | - | 949299..949697 (+) | 399 | WP_143978750.1 | HK97 gp10 family phage protein | - |
| MP619_RS04965 (MP619_04945) | - | 949690..950070 (+) | 381 | WP_155782967.1 | hypothetical protein | - |
| MP619_RS04970 (MP619_04950) | - | 950082..950666 (+) | 585 | WP_155782968.1 | major tail protein | - |
| MP619_RS04975 (MP619_04955) | - | 950759..951061 (+) | 303 | WP_155782969.1 | hypothetical protein | - |
| MP619_RS04980 (MP619_04960) | - | 951076..951243 (+) | 168 | WP_155782970.1 | hypothetical protein | - |
| MP619_RS04985 (MP619_04965) | - | 951287..955465 (+) | 4179 | WP_268227873.1 | phage tail tape measure protein | - |
| MP619_RS04990 (MP619_04970) | - | 955478..956248 (+) | 771 | WP_155782972.1 | distal tail protein Dit | - |
| MP619_RS04995 (MP619_04975) | - | 956245..958299 (+) | 2055 | WP_268227874.1 | phage tail spike protein | - |
| MP619_RS11615 | - | 958296..958799 (+) | 504 | Protein_935 | hyaluronoglucosaminidase | - |
| MP619_RS05005 (MP619_04985) | - | 959195..959533 (+) | 339 | WP_268227876.1 | hypothetical protein | - |
| MP619_RS05010 (MP619_04990) | - | 959544..961358 (+) | 1815 | WP_268227877.1 | gp58-like family protein | - |
| MP619_RS05015 (MP619_04995) | - | 961374..961808 (+) | 435 | WP_268227878.1 | DUF1617 family protein | - |
| MP619_RS05020 (MP619_05000) | - | 961906..962310 (+) | 405 | WP_129555899.1 | DUF1366 domain-containing protein | - |
| MP619_RS05025 (MP619_05005) | - | 962373..962531 (+) | 159 | WP_172595988.1 | hypothetical protein | - |
| MP619_RS05030 (MP619_05010) | - | 962540..962914 (+) | 375 | WP_129555898.1 | phage holin family protein | - |
| MP619_RS05035 (MP619_05015) | - | 963037..964233 (+) | 1197 | WP_268227879.1 | glucosaminidase domain-containing protein | - |
| MP619_RS05040 (MP619_05020) | - | 964438..964608 (+) | 171 | WP_155782710.1 | hypothetical protein | - |
| MP619_RS05045 (MP619_05025) | - | 964605..965186 (+) | 582 | WP_143935253.1 | hypothetical protein | - |
| MP619_RS05050 (MP619_05030) | prx | 965440..965622 (+) | 183 | WP_136059052.1 | Paratox | Regulator |
| MP619_RS05055 (MP619_05035) | ndk | 966048..966506 (+) | 459 | WP_003060137.1 | nucleoside-diphosphate kinase | - |
| MP619_RS05060 (MP619_05040) | lepA | 966576..968408 (+) | 1833 | WP_129555607.1 | translation elongation factor 4 | - |
| MP619_RS05065 (MP619_05045) | msrB | 968584..969021 (+) | 438 | WP_129555608.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| MP619_RS05070 (MP619_05050) | - | 969034..969684 (+) | 651 | WP_129555609.1 | HD domain-containing protein | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14871.80 Da Isoelectric Point: 7.1330
>NTDB_id=675093 MP619_RS04870 WP_155782953.1 937841..938233(+) (ssb) [Streptococcus dysgalactiae strain WJ001]
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRHFKNQDGQKVADFINCVMWRQAAENLTNWTKKGHLIAITGRIQTR
NYENQQGQRVYVTEVVAENFQILEKRDNTANTNSLADTMPDYGPEPDLPF
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRHFKNQDGQKVADFINCVMWRQAAENLTNWTKKGHLIAITGRIQTR
NYENQQGQRVYVTEVVAENFQILEKRDNTANTNSLADTMPDYGPEPDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=675093 MP619_RS04870 WP_155782953.1 937841..938233(+) (ssb) [Streptococcus dysgalactiae strain WJ001]
ATGATCAATAACGTTGTCTTGATTGGCCGCTTAACCAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTCATTTTAAAAATCAAGATGGGCAAAAAGTAGCTGATTTTATTAATTGTGTGATGT
GGCGACAAGCTGCTGAAAATTTAACAAATTGGACTAAAAAGGGCCATCTGATTGCGATAACAGGACGCATTCAGACCCGT
AACTATGAGAATCAACAAGGTCAACGTGTTTACGTGACAGAAGTGGTTGCCGAAAACTTTCAGATTCTTGAAAAGCGTGA
TAATACAGCTAATACTAATAGCTTGGCAGATACCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
ATGATCAATAACGTTGTCTTGATTGGCCGCTTAACCAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTCATTTTAAAAATCAAGATGGGCAAAAAGTAGCTGATTTTATTAATTGTGTGATGT
GGCGACAAGCTGCTGAAAATTTAACAAATTGGACTAAAAAGGGCCATCTGATTGCGATAACAGGACGCATTCAGACCCGT
AACTATGAGAATCAACAAGGTCAACGTGTTTACGTGACAGAAGTGGTTGCCGAAAACTTTCAGATTCTTGAAAAGCGTGA
TAATACAGCTAATACTAATAGCTTGGCAGATACCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
65.138 |
83.846 |
0.546 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
66.355 |
82.308 |
0.546 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.212 |
100 |
0.469 |
| ssbA | Streptococcus mutans UA159 |
43.704 |
100 |
0.454 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.182 |
100 |
0.438 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.424 |
100 |
0.431 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.424 |
100 |
0.431 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.424 |
100 |
0.431 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.424 |
100 |
0.431 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.424 |
100 |
0.431 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.887 |
81.538 |
0.423 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
39.535 |
99.231 |
0.392 |