Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA11_RS08115 | Genome accession | NZ_CP094808 |
| Coordinates | 1686798..1687217 (-) | Length | 139 a.a. |
| NCBI ID | WP_262625159.1 | Uniprot ID | - |
| Organism | Staphylococcus agnetis strain IVB6212 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1657776..1699979 | 1686798..1687217 | within | 0 |
Gene organization within MGE regions
Location: 1657776..1699979
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA11_RS07925 (MUA11_07915) | - | 1657776..1659245 (-) | 1470 | WP_262625136.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| MUA11_RS07930 (MUA11_07920) | - | 1659247..1659495 (-) | 249 | WP_194747456.1 | phage holin | - |
| MUA11_RS07935 (MUA11_07925) | - | 1659634..1659978 (-) | 345 | WP_060551317.1 | hypothetical protein | - |
| MUA11_RS07940 (MUA11_07930) | - | 1660026..1660340 (-) | 315 | WP_194747458.1 | hypothetical protein | - |
| MUA11_RS07945 (MUA11_07935) | - | 1660383..1660532 (-) | 150 | WP_194747460.1 | hypothetical protein | - |
| MUA11_RS07950 (MUA11_07940) | - | 1660543..1664025 (-) | 3483 | WP_262625137.1 | phage tail spike protein | - |
| MUA11_RS07955 (MUA11_07945) | - | 1664027..1665514 (-) | 1488 | WP_262625138.1 | phage tail family protein | - |
| MUA11_RS07960 (MUA11_07950) | - | 1666261..1670316 (-) | 4056 | Protein_1537 | phage tail tape measure protein | - |
| MUA11_RS07965 (MUA11_07955) | gpGT | 1670333..1670476 (-) | 144 | WP_262608247.1 | phage tail assembly chaperone GT | - |
| MUA11_RS07970 (MUA11_07960) | gpG | 1670536..1670907 (-) | 372 | WP_262608248.1 | phage tail assembly chaperone G | - |
| MUA11_RS07975 (MUA11_07965) | - | 1670967..1671146 (-) | 180 | WP_107371937.1 | hypothetical protein | - |
| MUA11_RS07980 (MUA11_07970) | - | 1671167..1671790 (-) | 624 | WP_262608250.1 | major tail protein | - |
| MUA11_RS07985 (MUA11_07975) | - | 1671803..1672213 (-) | 411 | WP_262625140.1 | hypothetical protein | - |
| MUA11_RS07990 (MUA11_07980) | - | 1672219..1672608 (-) | 390 | WP_262608252.1 | hypothetical protein | - |
| MUA11_RS07995 (MUA11_07985) | - | 1672598..1672966 (-) | 369 | WP_262608254.1 | hypothetical protein | - |
| MUA11_RS08000 (MUA11_07990) | - | 1672950..1673237 (-) | 288 | WP_262608255.1 | phage gp6-like head-tail connector protein | - |
| MUA11_RS08005 (MUA11_07995) | - | 1673255..1674463 (-) | 1209 | WP_262625141.1 | phage major capsid protein | - |
| MUA11_RS08010 (MUA11_08000) | - | 1674475..1675188 (-) | 714 | WP_262625142.1 | head maturation protease, ClpP-related | - |
| MUA11_RS08015 (MUA11_08005) | - | 1675151..1676329 (-) | 1179 | WP_262625143.1 | phage portal protein | - |
| MUA11_RS08020 (MUA11_08010) | - | 1676349..1678016 (-) | 1668 | WP_262625144.1 | terminase TerL endonuclease subunit | - |
| MUA11_RS08025 (MUA11_08015) | - | 1678003..1678385 (-) | 383 | Protein_1550 | hypothetical protein | - |
| MUA11_RS08030 (MUA11_08020) | - | 1678534..1678848 (-) | 315 | WP_262608260.1 | HNH endonuclease | - |
| MUA11_RS08035 (MUA11_08025) | - | 1679131..1679526 (-) | 396 | WP_262625145.1 | hypothetical protein | - |
| MUA11_RS08040 (MUA11_08030) | - | 1679792..1679980 (-) | 189 | WP_262625146.1 | hypothetical protein | - |
| MUA11_RS08045 (MUA11_08035) | - | 1680243..1680542 (-) | 300 | WP_165805114.1 | MazG-like family protein | - |
| MUA11_RS08050 (MUA11_08040) | - | 1680690..1681049 (-) | 360 | WP_262608263.1 | thermonuclease family protein | - |
| MUA11_RS08055 (MUA11_08045) | - | 1681056..1681292 (-) | 237 | WP_262625147.1 | hypothetical protein | - |
| MUA11_RS08060 (MUA11_08050) | - | 1681296..1681511 (-) | 216 | WP_262625148.1 | hypothetical protein | - |
| MUA11_RS08065 (MUA11_08055) | - | 1681498..1681749 (-) | 252 | WP_262625149.1 | hypothetical protein | - |
| MUA11_RS08070 (MUA11_08060) | - | 1681737..1682141 (-) | 405 | WP_262625150.1 | YopX family protein | - |
| MUA11_RS08075 (MUA11_08065) | - | 1682138..1682800 (-) | 663 | WP_262625151.1 | hypothetical protein | - |
| MUA11_RS08080 (MUA11_08070) | - | 1682910..1683125 (-) | 216 | WP_262625152.1 | DUF3269 family protein | - |
| MUA11_RS08085 (MUA11_08075) | - | 1683310..1683741 (-) | 432 | WP_262625153.1 | hypothetical protein | - |
| MUA11_RS08090 (MUA11_08080) | - | 1683743..1684159 (-) | 417 | WP_262625154.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MUA11_RS08100 (MUA11_08090) | - | 1684323..1685108 (-) | 786 | WP_262625156.1 | ATP-binding protein | - |
| MUA11_RS08105 (MUA11_08095) | - | 1685109..1685879 (-) | 771 | WP_262625157.1 | conserved phage C-terminal domain-containing protein | - |
| MUA11_RS08110 (MUA11_08100) | - | 1686115..1686786 (-) | 672 | WP_262625158.1 | putative HNHc nuclease | - |
| MUA11_RS08115 (MUA11_08105) | ssbA | 1686798..1687217 (-) | 420 | WP_262625159.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA11_RS08120 (MUA11_08110) | - | 1687210..1687854 (-) | 645 | WP_262625160.1 | ERF family protein | - |
| MUA11_RS08125 (MUA11_08115) | - | 1687851..1688069 (-) | 219 | WP_262608279.1 | DUF2483 domain-containing protein | - |
| MUA11_RS08130 (MUA11_08120) | - | 1688066..1688332 (-) | 267 | WP_262625161.1 | DUF1108 family protein | - |
| MUA11_RS08135 (MUA11_08125) | - | 1688587..1688913 (-) | 327 | WP_262625162.1 | DUF771 domain-containing protein | - |
| MUA11_RS08140 (MUA11_08130) | - | 1689061..1689378 (+) | 318 | WP_096540483.1 | hypothetical protein | - |
| MUA11_RS08145 (MUA11_08135) | - | 1689362..1689628 (-) | 267 | WP_262625163.1 | DUF2829 domain-containing protein | - |
| MUA11_RS08150 (MUA11_08140) | tscA | 1689663..1689887 (-) | 225 | WP_107362097.1 | type II toxin-antitoxin system antitoxin TscA | - |
| MUA11_RS08155 (MUA11_08145) | - | 1689887..1690387 (-) | 501 | WP_262625164.1 | ORF6C domain-containing protein | - |
| MUA11_RS08160 (MUA11_08150) | - | 1690400..1691281 (-) | 882 | WP_262625165.1 | DUF3102 domain-containing protein | - |
| MUA11_RS08165 (MUA11_08155) | - | 1691320..1691529 (-) | 210 | WP_217845906.1 | helix-turn-helix transcriptional regulator | - |
| MUA11_RS08170 (MUA11_08160) | - | 1691695..1692024 (+) | 330 | WP_262625166.1 | helix-turn-helix transcriptional regulator | - |
| MUA11_RS08175 (MUA11_08165) | - | 1692048..1692506 (+) | 459 | WP_262625167.1 | toxin | - |
| MUA11_RS08180 (MUA11_08170) | - | 1692554..1693132 (+) | 579 | WP_262625168.1 | hypothetical protein | - |
| MUA11_RS08185 (MUA11_08175) | - | 1694127..1694780 (+) | 654 | WP_262569499.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA11_RS08190 (MUA11_08180) | - | 1694849..1695874 (+) | 1026 | WP_262608289.1 | site-specific integrase | - |
| MUA11_RS08200 (MUA11_08190) | - | 1697889..1699049 (-) | 1161 | WP_262625170.1 | MFS transporter | - |
| MUA11_RS08205 (MUA11_08195) | - | 1699620..1699979 (+) | 360 | WP_262625171.1 | complement inhibitor SCIN family protein | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15567.14 Da Isoelectric Point: 4.9221
>NTDB_id=672990 MUA11_RS08115 WP_262625159.1 1686798..1687217(-) (ssbA) [Staphylococcus agnetis strain IVB6212]
MLNRAVLVGRLTKDPEFRTTPSGVDVSTFTLAVNRNFKSKDGEQQADFINCVVFRKQAENVKNYLSKGSLAGVDGRLQSR
SYENKEGQRVYVTEVVCDSVQFLEPKNNGQSNNQTKQQQGQAQDNPFDNASIDDDDLPF
MLNRAVLVGRLTKDPEFRTTPSGVDVSTFTLAVNRNFKSKDGEQQADFINCVVFRKQAENVKNYLSKGSLAGVDGRLQSR
SYENKEGQRVYVTEVVCDSVQFLEPKNNGQSNNQTKQQQGQAQDNPFDNASIDDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=672990 MUA11_RS08115 WP_262625159.1 1686798..1687217(-) (ssbA) [Staphylococcus agnetis strain IVB6212]
ATGCTTAACAGAGCCGTATTAGTAGGACGATTAACAAAAGACCCTGAATTCAGAACGACGCCATCAGGCGTAGACGTATC
AACTTTCACACTTGCAGTAAATCGCAATTTCAAAAGTAAAGACGGAGAACAACAAGCTGACTTTATTAATTGCGTAGTAT
TCCGAAAGCAAGCTGAAAACGTTAAAAACTATTTAAGTAAAGGGAGTTTAGCAGGCGTTGATGGGCGACTGCAGTCACGA
AGCTATGAAAATAAAGAAGGACAACGTGTGTATGTAACGGAAGTTGTGTGCGACAGTGTGCAATTTTTAGAACCTAAAAA
TAATGGTCAATCCAACAATCAAACTAAACAACAACAAGGGCAAGCGCAGGATAATCCTTTTGATAACGCTAGTATCGATG
ATGACGATTTACCTTTCTAG
ATGCTTAACAGAGCCGTATTAGTAGGACGATTAACAAAAGACCCTGAATTCAGAACGACGCCATCAGGCGTAGACGTATC
AACTTTCACACTTGCAGTAAATCGCAATTTCAAAAGTAAAGACGGAGAACAACAAGCTGACTTTATTAATTGCGTAGTAT
TCCGAAAGCAAGCTGAAAACGTTAAAAACTATTTAAGTAAAGGGAGTTTAGCAGGCGTTGATGGGCGACTGCAGTCACGA
AGCTATGAAAATAAAGAAGGACAACGTGTGTATGTAACGGAAGTTGTGTGCGACAGTGTGCAATTTTTAGAACCTAAAAA
TAATGGTCAATCCAACAATCAAACTAAACAACAACAAGGGCAAGCGCAGGATAATCCTTTTGATAACGCTAGTATCGATG
ATGACGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.233 |
100 |
0.683 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.412 |
100 |
0.604 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
76.259 |
0.446 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.781 |
100 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
42.446 |
100 |
0.424 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
38.129 |
100 |
0.381 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
38.129 |
100 |
0.381 |
| ssb | Vibrio cholerae strain A1552 |
30.233 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.41 |
100 |
0.374 |