Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA75_RS01485 | Genome accession | NZ_CP094795 |
| Coordinates | 341400..341828 (+) | Length | 142 a.a. |
| NCBI ID | WP_197851976.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain IVB6164 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 332510..373942 | 341400..341828 | within | 0 |
Gene organization within MGE regions
Location: 332510..373942
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA75_RS01390 (MUA75_01385) | - | 332510..333715 (-) | 1206 | WP_250406142.1 | tyrosine-type recombinase/integrase | - |
| MUA75_RS01395 (MUA75_01390) | - | 333778..334434 (-) | 657 | WP_045178546.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA75_RS01400 (MUA75_01395) | - | 334593..335363 (-) | 771 | WP_045178547.1 | S24 family peptidase | - |
| MUA75_RS01405 (MUA75_01400) | - | 335523..335747 (+) | 225 | WP_262542115.1 | DUF739 family protein | - |
| MUA75_RS01410 (MUA75_01405) | - | 335768..336211 (+) | 444 | WP_250406141.1 | hypothetical protein | - |
| MUA75_RS01415 (MUA75_01410) | - | 336226..336366 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| MUA75_RS01420 (MUA75_01415) | - | 336381..337013 (-) | 633 | WP_252550610.1 | hypothetical protein | - |
| MUA75_RS01425 (MUA75_01420) | - | 337070..337813 (+) | 744 | WP_252550608.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA75_RS01430 (MUA75_01425) | - | 337838..338032 (+) | 195 | WP_252550606.1 | hypothetical protein | - |
| MUA75_RS01435 (MUA75_01430) | - | 338027..338383 (-) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| MUA75_RS01440 (MUA75_01435) | - | 338433..338624 (+) | 192 | WP_000389905.1 | hypothetical protein | - |
| MUA75_RS01445 (MUA75_01440) | - | 338626..338853 (-) | 228 | WP_000801108.1 | hypothetical protein | - |
| MUA75_RS01450 (MUA75_01445) | - | 338909..339235 (+) | 327 | WP_001025595.1 | hypothetical protein | - |
| MUA75_RS01455 (MUA75_01450) | - | 339232..339331 (+) | 100 | Protein_288 | hypothetical protein | - |
| MUA75_RS01460 (MUA75_01455) | - | 339480..339743 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| MUA75_RS01465 (MUA75_01460) | - | 339755..339916 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| MUA75_RS01470 (MUA75_01465) | - | 340010..340270 (+) | 261 | WP_252550604.1 | DUF1108 family protein | - |
| MUA75_RS01475 (MUA75_01470) | - | 340284..340763 (+) | 480 | WP_115385576.1 | siphovirus Gp157 family protein | - |
| MUA75_RS01480 (MUA75_01475) | - | 340763..341400 (+) | 638 | Protein_293 | ERF family protein | - |
| MUA75_RS01485 (MUA75_01480) | ssbA | 341400..341828 (+) | 429 | WP_197851976.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA75_RS01490 (MUA75_01485) | - | 341842..342537 (+) | 696 | WP_197851974.1 | putative HNHc nuclease | - |
| MUA75_RS01495 (MUA75_01490) | - | 342509..343330 (+) | 822 | WP_162642963.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MUA75_RS01500 (MUA75_01495) | - | 343495..344127 (+) | 633 | WP_262629984.1 | ATP-binding protein | - |
| MUA75_RS01505 (MUA75_01500) | - | 344124..344284 (+) | 161 | Protein_298 | hypothetical protein | - |
| MUA75_RS01510 (MUA75_01505) | - | 344297..344518 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| MUA75_RS01515 (MUA75_01510) | - | 344529..344933 (+) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| MUA75_RS01520 (MUA75_01515) | - | 344938..345123 (+) | 186 | WP_001187242.1 | DUF3113 family protein | - |
| MUA75_RS01525 (MUA75_01520) | - | 345124..345741 (+) | 618 | WP_262529389.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA75_RS01530 (MUA75_01525) | - | 345741..345998 (+) | 258 | WP_031864864.1 | DUF3310 domain-containing protein | - |
| MUA75_RS01535 (MUA75_01530) | - | 346001..346201 (+) | 201 | WP_252549766.1 | hypothetical protein | - |
| MUA75_RS01540 (MUA75_01535) | - | 346198..346887 (+) | 690 | WP_252549763.1 | N-6 DNA methylase | - |
| MUA75_RS01545 (MUA75_01540) | - | 346901..347107 (+) | 207 | WP_252549760.1 | hypothetical protein | - |
| MUA75_RS01550 (MUA75_01545) | - | 347135..347536 (+) | 402 | WP_252549758.1 | hypothetical protein | - |
| MUA75_RS01555 (MUA75_01550) | - | 347533..347880 (+) | 348 | WP_252570428.1 | YopX family protein | - |
| MUA75_RS01560 (MUA75_01555) | - | 347877..348185 (+) | 309 | WP_398572652.1 | hypothetical protein | - |
| MUA75_RS01565 (MUA75_01560) | - | 348178..348429 (+) | 252 | WP_110166336.1 | DUF1024 family protein | - |
| MUA75_RS01570 (MUA75_01565) | - | 348419..348592 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| MUA75_RS01575 (MUA75_01570) | - | 348593..348874 (+) | 282 | WP_000454994.1 | hypothetical protein | - |
| MUA75_RS01580 (MUA75_01575) | - | 348875..349036 (+) | 162 | WP_000889683.1 | hypothetical protein | - |
| MUA75_RS01585 (MUA75_01580) | - | 349051..349584 (+) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| MUA75_RS01590 (MUA75_01585) | - | 349621..349827 (+) | 207 | WP_033859700.1 | DUF1381 domain-containing protein | - |
| MUA75_RS01595 (MUA75_01590) | rinB | 349824..349973 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MUA75_RS01600 (MUA75_01595) | - | 349973..350173 (+) | 201 | WP_111761860.1 | DUF1514 family protein | - |
| MUA75_RS01605 (MUA75_01600) | - | 350196..350657 (+) | 462 | WP_086037675.1 | hypothetical protein | - |
| MUA75_RS01610 (MUA75_01605) | - | 350772..351224 (+) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| MUA75_RS01615 (MUA75_01610) | - | 351240..351584 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| MUA75_RS01620 (MUA75_01615) | - | 351713..352183 (+) | 471 | WP_262629987.1 | phage terminase small subunit P27 family | - |
| MUA75_RS01625 (MUA75_01620) | - | 352183..353877 (+) | 1695 | WP_086037673.1 | terminase large subunit | - |
| MUA75_RS01630 (MUA75_01625) | - | 353891..354091 (+) | 201 | WP_000365300.1 | hypothetical protein | - |
| MUA75_RS01635 (MUA75_01630) | - | 354097..355347 (+) | 1251 | WP_045178579.1 | phage portal protein | - |
| MUA75_RS01640 (MUA75_01635) | - | 355340..355924 (+) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| MUA75_RS01645 (MUA75_01640) | - | 356012..357259 (+) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| MUA75_RS01650 (MUA75_01645) | - | 357295..357453 (+) | 159 | WP_001252099.1 | hypothetical protein | - |
| MUA75_RS01655 (MUA75_01650) | - | 357462..357794 (+) | 333 | WP_001177483.1 | head-tail connector protein | - |
| MUA75_RS01660 (MUA75_01655) | - | 357781..358116 (+) | 336 | WP_262630189.1 | head-tail adaptor protein | - |
| MUA75_RS01665 (MUA75_01660) | - | 358116..358493 (+) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MUA75_RS01670 (MUA75_01665) | - | 358490..358858 (+) | 369 | WP_262629989.1 | hypothetical protein | - |
| MUA75_RS01675 (MUA75_01670) | - | 358871..359824 (+) | 954 | WP_262629991.1 | major tail protein | - |
| MUA75_RS01680 (MUA75_01675) | gpG | 359889..360335 (+) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| MUA75_RS01685 (MUA75_01680) | gpGT | 360395..360517 (+) | 123 | WP_000570353.1 | phage tail assembly chaperone GT | - |
| MUA75_RS01690 (MUA75_01685) | - | 360573..365225 (+) | 4653 | WP_262629992.1 | phage tail tape measure protein | - |
| MUA75_RS01695 (MUA75_01690) | - | 365225..366715 (+) | 1491 | WP_106096714.1 | phage distal tail protein | - |
| MUA75_RS01700 (MUA75_01695) | - | 366731..370516 (+) | 3786 | Protein_337 | phage tail spike protein | - |
| MUA75_RS01705 (MUA75_01700) | - | 370506..370658 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| MUA75_RS01710 (MUA75_01705) | - | 370704..370991 (+) | 288 | WP_162636283.1 | hypothetical protein | - |
| MUA75_RS01715 (MUA75_01710) | - | 371047..371421 (+) | 375 | WP_000340974.1 | hypothetical protein | - |
| MUA75_RS01720 (MUA75_01715) | - | 371548..371985 (+) | 438 | WP_045179064.1 | phage holin | - |
| MUA75_RS01725 (MUA75_01720) | - | 371966..373411 (+) | 1446 | Protein_342 | SH3 domain-containing protein | - |
| MUA75_RS01730 (MUA75_01725) | - | 373640..373942 (+) | 303 | Protein_343 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16035.64 Da Isoelectric Point: 6.9799
>NTDB_id=672700 MUA75_RS01485 WP_197851976.1 341400..341828(+) (ssbA) [Staphylococcus aureus strain IVB6164]
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=672700 MUA75_RS01485 WP_197851976.1 341400..341828(+) (ssbA) [Staphylococcus aureus strain IVB6164]
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.302 |
100 |
0.718 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.627 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
74.648 |
0.444 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.357 |
100 |
0.437 |
| ssbA | Streptococcus mutans UA159 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.549 |
100 |
0.415 |
| ssb | Vibrio cholerae strain A1552 |
30.814 |
100 |
0.373 |