Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA18_RS01475 | Genome accession | NZ_CP094780 |
| Coordinates | 340354..340782 (+) | Length | 142 a.a. |
| NCBI ID | WP_197851976.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain IVB6173 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 331464..372897 | 340354..340782 | within | 0 |
Gene organization within MGE regions
Location: 331464..372897
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA18_RS01375 (MUA18_01375) | - | 331464..332669 (-) | 1206 | WP_262542113.1 | site-specific integrase | - |
| MUA18_RS01380 (MUA18_01380) | - | 332732..333388 (-) | 657 | WP_045178546.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA18_RS01385 (MUA18_01385) | - | 333547..334317 (-) | 771 | WP_045178547.1 | S24 family peptidase | - |
| MUA18_RS01390 (MUA18_01390) | - | 334477..334701 (+) | 225 | WP_262542115.1 | DUF739 family protein | - |
| MUA18_RS01395 (MUA18_01395) | - | 334722..335165 (+) | 444 | WP_250406141.1 | hypothetical protein | - |
| MUA18_RS01400 (MUA18_01400) | - | 335180..335320 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| MUA18_RS01405 (MUA18_01405) | - | 335335..335967 (-) | 633 | WP_252550610.1 | hypothetical protein | - |
| MUA18_RS01410 (MUA18_01410) | - | 336024..336767 (+) | 744 | WP_262542117.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA18_RS01415 (MUA18_01415) | - | 336792..336986 (+) | 195 | WP_252550606.1 | hypothetical protein | - |
| MUA18_RS01420 (MUA18_01420) | - | 336981..337337 (-) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| MUA18_RS01425 (MUA18_01425) | - | 337387..337578 (+) | 192 | WP_000389905.1 | hypothetical protein | - |
| MUA18_RS01430 (MUA18_01430) | - | 337580..337807 (-) | 228 | WP_000801108.1 | hypothetical protein | - |
| MUA18_RS01435 (MUA18_01435) | - | 337863..338189 (+) | 327 | WP_262542119.1 | hypothetical protein | - |
| MUA18_RS01440 (MUA18_01440) | - | 338186..338285 (+) | 100 | Protein_285 | hypothetical protein | - |
| MUA18_RS01445 (MUA18_01445) | - | 338434..338697 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| MUA18_RS01450 (MUA18_01450) | - | 338709..338870 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| MUA18_RS01455 (MUA18_01455) | - | 338964..339224 (+) | 261 | WP_252550604.1 | DUF1108 family protein | - |
| MUA18_RS01460 (MUA18_01460) | - | 339238..339717 (+) | 480 | WP_115385576.1 | siphovirus Gp157 family protein | - |
| MUA18_RS13885 | - | 339717..340354 (+) | 638 | Protein_290 | ERF family protein | - |
| MUA18_RS01475 (MUA18_01475) | ssbA | 340354..340782 (+) | 429 | WP_197851976.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA18_RS01480 (MUA18_01480) | - | 340796..341491 (+) | 696 | WP_197851974.1 | putative HNHc nuclease | - |
| MUA18_RS01485 (MUA18_01485) | - | 341463..342284 (+) | 822 | WP_162642963.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MUA18_RS01490 (MUA18_01490) | - | 342297..343082 (+) | 786 | WP_262542124.1 | ATP-binding protein | - |
| MUA18_RS01495 (MUA18_01495) | - | 343079..343239 (+) | 161 | Protein_295 | hypothetical protein | - |
| MUA18_RS01500 (MUA18_01500) | - | 343252..343473 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| MUA18_RS01505 (MUA18_01505) | - | 343484..343888 (+) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| MUA18_RS01510 (MUA18_01510) | - | 343893..344078 (+) | 186 | WP_001187242.1 | DUF3113 family protein | - |
| MUA18_RS01515 (MUA18_01515) | - | 344079..344696 (+) | 618 | WP_262529389.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA18_RS01520 (MUA18_01520) | - | 344696..344953 (+) | 258 | WP_031864864.1 | DUF3310 domain-containing protein | - |
| MUA18_RS01525 (MUA18_01525) | - | 344956..345156 (+) | 201 | WP_252549766.1 | hypothetical protein | - |
| MUA18_RS01530 (MUA18_01530) | - | 345153..345842 (+) | 690 | WP_252549763.1 | N-6 DNA methylase | - |
| MUA18_RS01535 (MUA18_01535) | - | 345856..346062 (+) | 207 | WP_252549760.1 | hypothetical protein | - |
| MUA18_RS01540 (MUA18_01540) | - | 346090..346491 (+) | 402 | WP_262542127.1 | hypothetical protein | - |
| MUA18_RS01545 (MUA18_01545) | - | 346488..346835 (+) | 348 | WP_252570428.1 | YopX family protein | - |
| MUA18_RS01550 (MUA18_01550) | - | 346832..347140 (+) | 309 | WP_398572652.1 | hypothetical protein | - |
| MUA18_RS01555 (MUA18_01555) | - | 347133..347384 (+) | 252 | WP_110166336.1 | DUF1024 family protein | - |
| MUA18_RS01560 (MUA18_01560) | - | 347374..347547 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| MUA18_RS01565 (MUA18_01565) | - | 347548..347829 (+) | 282 | WP_000454994.1 | hypothetical protein | - |
| MUA18_RS01570 (MUA18_01570) | - | 347830..347991 (+) | 162 | WP_000889683.1 | hypothetical protein | - |
| MUA18_RS01575 (MUA18_01575) | - | 348006..348539 (+) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| MUA18_RS01580 (MUA18_01580) | - | 348576..348782 (+) | 207 | WP_033859700.1 | DUF1381 domain-containing protein | - |
| MUA18_RS01585 (MUA18_01585) | rinB | 348779..348928 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MUA18_RS01590 (MUA18_01590) | - | 348928..349128 (+) | 201 | WP_111761860.1 | DUF1514 family protein | - |
| MUA18_RS01595 (MUA18_01595) | - | 349151..349612 (+) | 462 | WP_086037675.1 | hypothetical protein | - |
| MUA18_RS01600 (MUA18_01600) | - | 349727..350179 (+) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| MUA18_RS01605 (MUA18_01605) | - | 350195..350539 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| MUA18_RS01610 (MUA18_01610) | - | 350668..351138 (+) | 471 | WP_086037674.1 | phage terminase small subunit P27 family | - |
| MUA18_RS01615 (MUA18_01615) | - | 351138..352832 (+) | 1695 | WP_086037673.1 | terminase large subunit | - |
| MUA18_RS01620 (MUA18_01620) | - | 352846..353046 (+) | 201 | WP_000365300.1 | hypothetical protein | - |
| MUA18_RS01625 (MUA18_01625) | - | 353052..354302 (+) | 1251 | WP_045178579.1 | phage portal protein | - |
| MUA18_RS01630 (MUA18_01630) | - | 354295..354879 (+) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| MUA18_RS01635 (MUA18_01635) | - | 354967..356214 (+) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| MUA18_RS01640 (MUA18_01640) | - | 356250..356408 (+) | 159 | WP_001252099.1 | hypothetical protein | - |
| MUA18_RS01645 (MUA18_01645) | - | 356417..356749 (+) | 333 | WP_001177483.1 | head-tail connector protein | - |
| MUA18_RS01650 (MUA18_01650) | - | 356736..357071 (+) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| MUA18_RS01655 (MUA18_01655) | - | 357071..357448 (+) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MUA18_RS01660 (MUA18_01660) | - | 357445..357825 (+) | 381 | WP_086037671.1 | hypothetical protein | - |
| MUA18_RS01665 (MUA18_01665) | - | 357826..358779 (+) | 954 | WP_086037669.1 | major tail protein | - |
| MUA18_RS01670 (MUA18_01670) | gpG | 358844..359290 (+) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| MUA18_RS01675 (MUA18_01675) | gpGT | 359350..359472 (+) | 123 | WP_000570353.1 | phage tail assembly chaperone GT | - |
| MUA18_RS01680 (MUA18_01680) | - | 359528..364180 (+) | 4653 | WP_262543079.1 | phage tail tape measure protein | - |
| MUA18_RS01685 (MUA18_01685) | - | 364180..365670 (+) | 1491 | WP_106096714.1 | phage distal tail protein | - |
| MUA18_RS01690 (MUA18_01690) | - | 365686..369471 (+) | 3786 | WP_252549737.1 | phage tail spike protein | - |
| MUA18_RS01695 (MUA18_01695) | - | 369461..369613 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| MUA18_RS01700 (MUA18_01700) | - | 369659..369946 (+) | 288 | WP_162636283.1 | hypothetical protein | - |
| MUA18_RS01705 (MUA18_01705) | - | 370002..370376 (+) | 375 | WP_000340974.1 | hypothetical protein | - |
| MUA18_RS01710 (MUA18_01710) | - | 370503..370940 (+) | 438 | WP_045179064.1 | phage holin | - |
| MUA18_RS01715 (MUA18_01715) | - | 370921..372366 (+) | 1446 | WP_262542137.1 | SH3 domain-containing protein | - |
| MUA18_RS01720 (MUA18_01720) | - | 372595..372897 (+) | 303 | Protein_340 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16035.64 Da Isoelectric Point: 6.9799
>NTDB_id=672401 MUA18_RS01475 WP_197851976.1 340354..340782(+) (ssbA) [Staphylococcus aureus strain IVB6173]
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=672401 MUA18_RS01475 WP_197851976.1 340354..340782(+) (ssbA) [Staphylococcus aureus strain IVB6173]
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.302 |
100 |
0.718 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.627 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
74.648 |
0.444 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.357 |
100 |
0.437 |
| ssbA | Streptococcus mutans UA159 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.549 |
100 |
0.415 |
| ssb | Vibrio cholerae strain A1552 |
30.814 |
100 |
0.373 |