Detailed information NTG0672084

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA83_RS08095
• Genome accession: NZ_CP094763
• Coordinates: 1660059..1660370 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain IVB6221
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1655059..1665370

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA83_RS08060 (MUA83_08055)	gcvPA	1655561..1656907 (-)	1347	WP_000019698.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
MUA83_RS08065 (MUA83_08060)	gcvT	1656927..1658018 (-)	1092	WP_000093354.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA83_RS08070 (MUA83_08065)	-	1658177..1658701 (-)	525	WP_001015120.1	shikimate kinase	-
MUA83_RS08075 (MUA83_08070)	-	1658691..1658837 (-)	147	WP_001789879.1	hypothetical protein	-
MUA83_RS08080 (MUA83_08075)	comGF	1658934..1659431 (-)	498	WP_262528782.1	competence type IV pilus minor pilin ComGF	Machinery gene
MUA83_RS08085 (MUA83_08080)	comGE	1659349..1659648 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
MUA83_RS08090 (MUA83_08085)	comGD	1659635..1660081 (-)	447	WP_072357807.1	competence type IV pilus minor pilin ComGD	Machinery gene
MUA83_RS08095 (MUA83_08090)	comGC	1660059..1660370 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA83_RS08100 (MUA83_08095)	comGB	1660384..1661454 (-)	1071	Protein_1593	competence type IV pilus assembly protein ComGB	-
MUA83_RS08105 (MUA83_08100)	comGA	1661426..1662400 (-)	975	WP_262528786.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA83_RS08110 (MUA83_08105)	-	1662452..1663075 (-)	624	WP_031872212.1	MBL fold metallo-hydrolase	-
MUA83_RS08115 (MUA83_08110)	-	1663072..1663401 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
MUA83_RS08120 (MUA83_08115)	-	1663401..1664387 (-)	987	WP_000161315.1	ROK family glucokinase	-
MUA83_RS08125 (MUA83_08120)	-	1664384..1664587 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=672084 MUA83_RS08095 WP_000472256.1 1660059..1660370(-) (comGC) [Staphylococcus aureus strain IVB6221]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=672084 MUA83_RS08095 WP_000472256.1 1660059..1660370(-) (comGC) [Staphylococcus aureus strain IVB6221]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369