Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA83_RS01460 | Genome accession | NZ_CP094763 |
| Coordinates | 338252..338680 (+) | Length | 142 a.a. |
| NCBI ID | WP_197851976.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain IVB6221 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 329363..370795 | 338252..338680 | within | 0 |
Gene organization within MGE regions
Location: 329363..370795
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA83_RS01365 (MUA83_01365) | - | 329363..330568 (-) | 1206 | WP_250406142.1 | tyrosine-type recombinase/integrase | - |
| MUA83_RS01370 (MUA83_01370) | - | 330631..331287 (-) | 657 | WP_045178546.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA83_RS01375 (MUA83_01375) | - | 331446..332216 (-) | 771 | WP_045178547.1 | S24 family peptidase | - |
| MUA83_RS01380 (MUA83_01380) | - | 332376..332600 (+) | 225 | WP_031768088.1 | DUF739 family protein | - |
| MUA83_RS01385 (MUA83_01385) | - | 332621..333064 (+) | 444 | WP_250406141.1 | hypothetical protein | - |
| MUA83_RS01390 (MUA83_01390) | - | 333079..333219 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| MUA83_RS01395 (MUA83_01395) | - | 333234..333866 (-) | 633 | WP_252550610.1 | hypothetical protein | - |
| MUA83_RS01400 (MUA83_01400) | - | 333923..334666 (+) | 744 | WP_252550608.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA83_RS01405 (MUA83_01405) | - | 334691..334885 (+) | 195 | WP_252550606.1 | hypothetical protein | - |
| MUA83_RS01410 (MUA83_01410) | - | 334880..335236 (-) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| MUA83_RS01415 (MUA83_01415) | - | 335286..335477 (+) | 192 | WP_000389905.1 | hypothetical protein | - |
| MUA83_RS01420 (MUA83_01420) | - | 335479..335706 (-) | 228 | WP_262529383.1 | hypothetical protein | - |
| MUA83_RS01425 (MUA83_01425) | - | 335762..336088 (+) | 327 | WP_001025595.1 | hypothetical protein | - |
| MUA83_RS01430 (MUA83_01430) | - | 336085..336184 (+) | 100 | Protein_282 | hypothetical protein | - |
| MUA83_RS01435 (MUA83_01435) | - | 336333..336595 (+) | 263 | Protein_283 | helix-turn-helix domain-containing protein | - |
| MUA83_RS01440 (MUA83_01440) | - | 336607..336768 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| MUA83_RS01445 (MUA83_01445) | - | 336862..337122 (+) | 261 | WP_252550604.1 | DUF1108 family protein | - |
| MUA83_RS01450 (MUA83_01450) | - | 337136..337615 (+) | 480 | WP_115385576.1 | siphovirus Gp157 family protein | - |
| MUA83_RS01455 (MUA83_01455) | - | 337615..338252 (+) | 638 | Protein_287 | ERF family protein | - |
| MUA83_RS01460 (MUA83_01460) | ssbA | 338252..338680 (+) | 429 | WP_197851976.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA83_RS01465 (MUA83_01465) | - | 338694..339389 (+) | 696 | WP_197851974.1 | putative HNHc nuclease | - |
| MUA83_RS01470 (MUA83_01470) | - | 339361..340182 (+) | 822 | WP_162642963.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MUA83_RS01475 (MUA83_01475) | - | 340195..340980 (+) | 786 | WP_262529385.1 | ATP-binding protein | - |
| MUA83_RS01480 (MUA83_01480) | - | 340977..341137 (+) | 161 | Protein_292 | hypothetical protein | - |
| MUA83_RS01485 (MUA83_01485) | - | 341150..341371 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| MUA83_RS01490 (MUA83_01490) | - | 341382..341786 (+) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| MUA83_RS01495 (MUA83_01495) | - | 341791..341976 (+) | 186 | WP_001187242.1 | DUF3113 family protein | - |
| MUA83_RS01500 (MUA83_01500) | - | 341977..342594 (+) | 618 | WP_262529389.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA83_RS01505 (MUA83_01505) | - | 342594..342851 (+) | 258 | WP_031864864.1 | DUF3310 domain-containing protein | - |
| MUA83_RS01510 (MUA83_01510) | - | 342854..343054 (+) | 201 | WP_252549766.1 | hypothetical protein | - |
| MUA83_RS01515 (MUA83_01515) | - | 343051..343740 (+) | 690 | WP_262529392.1 | SAM-dependent methyltransferase | - |
| MUA83_RS01520 (MUA83_01520) | - | 343754..343960 (+) | 207 | WP_252549760.1 | hypothetical protein | - |
| MUA83_RS01525 (MUA83_01525) | - | 343988..344389 (+) | 402 | WP_252549758.1 | hypothetical protein | - |
| MUA83_RS01530 (MUA83_01530) | - | 344386..344733 (+) | 348 | WP_252570428.1 | YopX family protein | - |
| MUA83_RS01535 (MUA83_01535) | - | 344730..345038 (+) | 309 | WP_398572652.1 | hypothetical protein | - |
| MUA83_RS01540 (MUA83_01540) | - | 345031..345282 (+) | 252 | WP_110166336.1 | DUF1024 family protein | - |
| MUA83_RS01545 (MUA83_01545) | - | 345272..345445 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| MUA83_RS01550 (MUA83_01550) | - | 345446..345727 (+) | 282 | WP_000454994.1 | hypothetical protein | - |
| MUA83_RS01555 (MUA83_01555) | - | 345728..345889 (+) | 162 | WP_000889683.1 | hypothetical protein | - |
| MUA83_RS01560 (MUA83_01560) | - | 345904..346437 (+) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| MUA83_RS01565 (MUA83_01565) | - | 346474..346680 (+) | 207 | WP_033859700.1 | DUF1381 domain-containing protein | - |
| MUA83_RS01570 (MUA83_01570) | rinB | 346677..346826 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MUA83_RS01575 (MUA83_01575) | - | 346826..347026 (+) | 201 | WP_111761860.1 | DUF1514 family protein | - |
| MUA83_RS01580 (MUA83_01580) | - | 347049..347510 (+) | 462 | WP_086037675.1 | hypothetical protein | - |
| MUA83_RS01585 (MUA83_01585) | - | 347625..348077 (+) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| MUA83_RS01590 (MUA83_01590) | - | 348093..348437 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| MUA83_RS01595 (MUA83_01595) | - | 348566..349036 (+) | 471 | WP_086037674.1 | phage terminase small subunit P27 family | - |
| MUA83_RS01600 (MUA83_01600) | - | 349036..350730 (+) | 1695 | WP_086037673.1 | terminase large subunit | - |
| MUA83_RS01605 (MUA83_01605) | - | 350744..350944 (+) | 201 | WP_000365300.1 | hypothetical protein | - |
| MUA83_RS01610 (MUA83_01610) | - | 350950..352200 (+) | 1251 | WP_045178579.1 | phage portal protein | - |
| MUA83_RS01615 (MUA83_01615) | - | 352193..352777 (+) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| MUA83_RS01620 (MUA83_01620) | - | 352865..354112 (+) | 1248 | WP_262529400.1 | phage major capsid protein | - |
| MUA83_RS01625 (MUA83_01625) | - | 354148..354306 (+) | 159 | WP_001252099.1 | hypothetical protein | - |
| MUA83_RS01630 (MUA83_01630) | - | 354315..354647 (+) | 333 | WP_001177483.1 | head-tail connector protein | - |
| MUA83_RS01635 (MUA83_01635) | - | 354634..354969 (+) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| MUA83_RS01640 (MUA83_01640) | - | 354969..355346 (+) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MUA83_RS01645 (MUA83_01645) | - | 355343..355723 (+) | 381 | WP_086037671.1 | hypothetical protein | - |
| MUA83_RS01650 (MUA83_01650) | - | 355724..356677 (+) | 954 | WP_262529405.1 | major tail protein | - |
| MUA83_RS01655 (MUA83_01655) | gpG | 356742..357188 (+) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| MUA83_RS01660 (MUA83_01660) | gpGT | 357248..357370 (+) | 123 | WP_000570353.1 | phage tail assembly chaperone GT | - |
| MUA83_RS01665 (MUA83_01665) | - | 357426..362078 (+) | 4653 | WP_262529408.1 | phage tail tape measure protein | - |
| MUA83_RS01670 (MUA83_01670) | - | 362078..363568 (+) | 1491 | WP_106096714.1 | phage distal tail protein | - |
| MUA83_RS01675 (MUA83_01675) | - | 363584..367369 (+) | 3786 | WP_252549737.1 | phage tail spike protein | - |
| MUA83_RS01680 (MUA83_01680) | - | 367359..367511 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| MUA83_RS01685 (MUA83_01685) | - | 367557..367844 (+) | 288 | WP_262529448.1 | hypothetical protein | - |
| MUA83_RS01690 (MUA83_01690) | - | 367900..368274 (+) | 375 | WP_262529450.1 | hypothetical protein | - |
| MUA83_RS01695 (MUA83_01695) | - | 368401..368838 (+) | 438 | WP_045179064.1 | phage holin | - |
| MUA83_RS01700 (MUA83_01700) | - | 368819..370264 (+) | 1446 | WP_031864827.1 | SH3 domain-containing protein | - |
| MUA83_RS01705 (MUA83_01705) | - | 370493..370795 (+) | 303 | Protein_337 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16035.64 Da Isoelectric Point: 6.9799
>NTDB_id=672065 MUA83_RS01460 WP_197851976.1 338252..338680(+) (ssbA) [Staphylococcus aureus strain IVB6221]
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=672065 MUA83_RS01460 WP_197851976.1 338252..338680(+) (ssbA) [Staphylococcus aureus strain IVB6221]
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.302 |
100 |
0.718 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.627 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
74.648 |
0.444 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.357 |
100 |
0.437 |
| ssbA | Streptococcus mutans UA159 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.549 |
100 |
0.415 |
| ssb | Vibrio cholerae strain A1552 |
30.814 |
100 |
0.373 |