Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA07_RS01485 | Genome accession | NZ_CP094750 |
| Coordinates | 341331..341759 (+) | Length | 142 a.a. |
| NCBI ID | WP_197851976.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain IVB6248 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 332441..373874 | 341331..341759 | within | 0 |
Gene organization within MGE regions
Location: 332441..373874
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA07_RS01385 (MUA07_01385) | - | 332441..333646 (-) | 1206 | WP_262542113.1 | site-specific integrase | - |
| MUA07_RS01390 (MUA07_01390) | - | 333709..334365 (-) | 657 | WP_045178546.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA07_RS01395 (MUA07_01395) | - | 334524..335294 (-) | 771 | WP_045178547.1 | S24 family peptidase | - |
| MUA07_RS01400 (MUA07_01400) | - | 335454..335678 (+) | 225 | WP_262542115.1 | DUF739 family protein | - |
| MUA07_RS01405 (MUA07_01405) | - | 335699..336142 (+) | 444 | WP_250406141.1 | hypothetical protein | - |
| MUA07_RS01410 (MUA07_01410) | - | 336157..336297 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| MUA07_RS01415 (MUA07_01415) | - | 336312..336944 (-) | 633 | WP_252550610.1 | hypothetical protein | - |
| MUA07_RS01420 (MUA07_01420) | - | 337001..337744 (+) | 744 | WP_262542117.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA07_RS01425 (MUA07_01425) | - | 337769..337963 (+) | 195 | WP_252550606.1 | hypothetical protein | - |
| MUA07_RS01430 (MUA07_01430) | - | 337958..338314 (-) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| MUA07_RS01435 (MUA07_01435) | - | 338364..338555 (+) | 192 | WP_000389905.1 | hypothetical protein | - |
| MUA07_RS01440 (MUA07_01440) | - | 338557..338784 (-) | 228 | WP_000801108.1 | hypothetical protein | - |
| MUA07_RS01445 (MUA07_01445) | - | 338840..339166 (+) | 327 | WP_262542119.1 | hypothetical protein | - |
| MUA07_RS01450 (MUA07_01450) | - | 339163..339262 (+) | 100 | Protein_287 | hypothetical protein | - |
| MUA07_RS01455 (MUA07_01455) | - | 339411..339674 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| MUA07_RS01460 (MUA07_01460) | - | 339686..339847 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| MUA07_RS01465 (MUA07_01465) | - | 339941..340201 (+) | 261 | WP_252550604.1 | DUF1108 family protein | - |
| MUA07_RS01470 (MUA07_01470) | - | 340215..340694 (+) | 480 | WP_262542121.1 | siphovirus Gp157 family protein | - |
| MUA07_RS13900 | - | 340694..341331 (+) | 638 | Protein_292 | ERF family protein | - |
| MUA07_RS01485 (MUA07_01485) | ssbA | 341331..341759 (+) | 429 | WP_197851976.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA07_RS01490 (MUA07_01490) | - | 341773..342468 (+) | 696 | WP_197851974.1 | putative HNHc nuclease | - |
| MUA07_RS01495 (MUA07_01495) | - | 342440..343261 (+) | 822 | WP_162642963.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MUA07_RS01500 (MUA07_01500) | - | 343274..344059 (+) | 786 | WP_262542124.1 | ATP-binding protein | - |
| MUA07_RS01505 (MUA07_01505) | - | 344056..344216 (+) | 161 | Protein_297 | hypothetical protein | - |
| MUA07_RS01510 (MUA07_01510) | - | 344229..344450 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| MUA07_RS01515 (MUA07_01515) | - | 344461..344865 (+) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| MUA07_RS01520 (MUA07_01520) | - | 344870..345055 (+) | 186 | WP_001187242.1 | DUF3113 family protein | - |
| MUA07_RS01525 (MUA07_01525) | - | 345056..345673 (+) | 618 | WP_262529389.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA07_RS01530 (MUA07_01530) | - | 345673..345930 (+) | 258 | WP_031864864.1 | DUF3310 domain-containing protein | - |
| MUA07_RS01535 (MUA07_01535) | - | 345933..346133 (+) | 201 | WP_252549766.1 | hypothetical protein | - |
| MUA07_RS01540 (MUA07_01540) | - | 346130..346819 (+) | 690 | WP_252549763.1 | N-6 DNA methylase | - |
| MUA07_RS01545 (MUA07_01545) | - | 346833..347039 (+) | 207 | WP_252549760.1 | hypothetical protein | - |
| MUA07_RS01550 (MUA07_01550) | - | 347067..347468 (+) | 402 | WP_262542127.1 | hypothetical protein | - |
| MUA07_RS01555 (MUA07_01555) | - | 347465..347812 (+) | 348 | WP_252570428.1 | YopX family protein | - |
| MUA07_RS01560 (MUA07_01560) | - | 347809..348117 (+) | 309 | WP_398572652.1 | hypothetical protein | - |
| MUA07_RS01565 (MUA07_01565) | - | 348110..348361 (+) | 252 | WP_110166336.1 | DUF1024 family protein | - |
| MUA07_RS01570 (MUA07_01570) | - | 348351..348524 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| MUA07_RS01575 (MUA07_01575) | - | 348525..348806 (+) | 282 | WP_000454994.1 | hypothetical protein | - |
| MUA07_RS01580 (MUA07_01580) | - | 348807..348968 (+) | 162 | WP_000889683.1 | hypothetical protein | - |
| MUA07_RS01585 (MUA07_01585) | - | 348983..349516 (+) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| MUA07_RS01590 (MUA07_01590) | - | 349553..349759 (+) | 207 | WP_033859700.1 | DUF1381 domain-containing protein | - |
| MUA07_RS01595 (MUA07_01595) | rinB | 349756..349905 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MUA07_RS01600 (MUA07_01600) | - | 349905..350105 (+) | 201 | WP_111761860.1 | DUF1514 family protein | - |
| MUA07_RS01605 (MUA07_01605) | - | 350128..350589 (+) | 462 | WP_086037675.1 | hypothetical protein | - |
| MUA07_RS01610 (MUA07_01610) | - | 350704..351156 (+) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| MUA07_RS01615 (MUA07_01615) | - | 351172..351516 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| MUA07_RS01620 (MUA07_01620) | - | 351645..352115 (+) | 471 | WP_262542129.1 | phage terminase small subunit P27 family | - |
| MUA07_RS01625 (MUA07_01625) | - | 352115..353809 (+) | 1695 | WP_086037673.1 | terminase large subunit | - |
| MUA07_RS01630 (MUA07_01630) | - | 353823..354023 (+) | 201 | WP_000365300.1 | hypothetical protein | - |
| MUA07_RS01635 (MUA07_01635) | - | 354029..355279 (+) | 1251 | WP_045178579.1 | phage portal protein | - |
| MUA07_RS01640 (MUA07_01640) | - | 355272..355856 (+) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| MUA07_RS01645 (MUA07_01645) | - | 355944..357191 (+) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| MUA07_RS01650 (MUA07_01650) | - | 357227..357385 (+) | 159 | WP_001252099.1 | hypothetical protein | - |
| MUA07_RS01655 (MUA07_01655) | - | 357394..357726 (+) | 333 | WP_001177483.1 | head-tail connector protein | - |
| MUA07_RS01660 (MUA07_01660) | - | 357713..358048 (+) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| MUA07_RS01665 (MUA07_01665) | - | 358048..358425 (+) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MUA07_RS01670 (MUA07_01670) | - | 358422..358802 (+) | 381 | WP_262542132.1 | hypothetical protein | - |
| MUA07_RS01675 (MUA07_01675) | - | 358803..359756 (+) | 954 | WP_086037669.1 | major tail protein | - |
| MUA07_RS01680 (MUA07_01680) | gpG | 359821..360267 (+) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| MUA07_RS01685 (MUA07_01685) | gpGT | 360327..360449 (+) | 123 | WP_000570353.1 | phage tail assembly chaperone GT | - |
| MUA07_RS01690 (MUA07_01690) | - | 360505..365157 (+) | 4653 | WP_262542135.1 | phage tail tape measure protein | - |
| MUA07_RS01695 (MUA07_01695) | - | 365157..366647 (+) | 1491 | WP_106096714.1 | phage distal tail protein | - |
| MUA07_RS01700 (MUA07_01700) | - | 366663..370448 (+) | 3786 | WP_252549737.1 | phage tail spike protein | - |
| MUA07_RS01705 (MUA07_01705) | - | 370438..370590 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| MUA07_RS01710 (MUA07_01710) | - | 370636..370923 (+) | 288 | WP_162636283.1 | hypothetical protein | - |
| MUA07_RS01715 (MUA07_01715) | - | 370979..371353 (+) | 375 | WP_000340974.1 | hypothetical protein | - |
| MUA07_RS01720 (MUA07_01720) | - | 371480..371917 (+) | 438 | WP_045179064.1 | phage holin | - |
| MUA07_RS01725 (MUA07_01725) | - | 371898..373343 (+) | 1446 | WP_262542137.1 | SH3 domain-containing protein | - |
| MUA07_RS01730 (MUA07_01730) | - | 373572..373874 (+) | 303 | Protein_342 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16035.64 Da Isoelectric Point: 6.9799
>NTDB_id=671900 MUA07_RS01485 WP_197851976.1 341331..341759(+) (ssbA) [Staphylococcus aureus strain IVB6248]
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=671900 MUA07_RS01485 WP_197851976.1 341331..341759(+) (ssbA) [Staphylococcus aureus strain IVB6248]
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.302 |
100 |
0.718 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.627 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
74.648 |
0.444 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.357 |
100 |
0.437 |
| ssbA | Streptococcus mutans UA159 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.549 |
100 |
0.415 |
| ssb | Vibrio cholerae strain A1552 |
30.814 |
100 |
0.373 |