Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA62_RS01485 | Genome accession | NZ_CP094743 |
| Coordinates | 341354..341782 (+) | Length | 142 a.a. |
| NCBI ID | WP_197851976.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain IVB6252 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 332464..373897 | 341354..341782 | within | 0 |
Gene organization within MGE regions
Location: 332464..373897
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA62_RS01385 (MUA62_01385) | - | 332464..333669 (-) | 1206 | WP_262542113.1 | site-specific integrase | - |
| MUA62_RS01390 (MUA62_01390) | - | 333732..334388 (-) | 657 | WP_045178546.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA62_RS01395 (MUA62_01395) | - | 334547..335317 (-) | 771 | WP_045178547.1 | S24 family peptidase | - |
| MUA62_RS01400 (MUA62_01400) | - | 335477..335701 (+) | 225 | WP_262542115.1 | DUF739 family protein | - |
| MUA62_RS01405 (MUA62_01405) | - | 335722..336165 (+) | 444 | WP_250406141.1 | hypothetical protein | - |
| MUA62_RS01410 (MUA62_01410) | - | 336180..336320 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| MUA62_RS01415 (MUA62_01415) | - | 336335..336967 (-) | 633 | WP_252550610.1 | hypothetical protein | - |
| MUA62_RS01420 (MUA62_01420) | - | 337024..337767 (+) | 744 | WP_262542117.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA62_RS01425 (MUA62_01425) | - | 337792..337986 (+) | 195 | WP_252550606.1 | hypothetical protein | - |
| MUA62_RS01430 (MUA62_01430) | - | 337981..338337 (-) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| MUA62_RS01435 (MUA62_01435) | - | 338387..338578 (+) | 192 | WP_000389905.1 | hypothetical protein | - |
| MUA62_RS01440 (MUA62_01440) | - | 338580..338807 (-) | 228 | WP_000801108.1 | hypothetical protein | - |
| MUA62_RS01445 (MUA62_01445) | - | 338863..339189 (+) | 327 | WP_262542119.1 | hypothetical protein | - |
| MUA62_RS01450 (MUA62_01450) | - | 339186..339285 (+) | 100 | Protein_287 | hypothetical protein | - |
| MUA62_RS01455 (MUA62_01455) | - | 339434..339697 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| MUA62_RS01460 (MUA62_01460) | - | 339709..339870 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| MUA62_RS01465 (MUA62_01465) | - | 339964..340224 (+) | 261 | WP_252550604.1 | DUF1108 family protein | - |
| MUA62_RS01470 (MUA62_01470) | - | 340238..340717 (+) | 480 | WP_262542121.1 | siphovirus Gp157 family protein | - |
| MUA62_RS13875 | - | 340717..341354 (+) | 638 | Protein_292 | ERF family protein | - |
| MUA62_RS01485 (MUA62_01485) | ssbA | 341354..341782 (+) | 429 | WP_197851976.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA62_RS01490 (MUA62_01490) | - | 341796..342491 (+) | 696 | WP_197851974.1 | putative HNHc nuclease | - |
| MUA62_RS01495 (MUA62_01495) | - | 342463..343284 (+) | 822 | WP_162642963.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MUA62_RS01500 (MUA62_01500) | - | 343297..344082 (+) | 786 | WP_262542124.1 | ATP-binding protein | - |
| MUA62_RS01505 (MUA62_01505) | - | 344079..344239 (+) | 161 | Protein_297 | hypothetical protein | - |
| MUA62_RS01510 (MUA62_01510) | - | 344252..344473 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| MUA62_RS01515 (MUA62_01515) | - | 344484..344888 (+) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| MUA62_RS01520 (MUA62_01520) | - | 344893..345078 (+) | 186 | WP_001187242.1 | DUF3113 family protein | - |
| MUA62_RS01525 (MUA62_01525) | - | 345079..345696 (+) | 618 | WP_262529389.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA62_RS01530 (MUA62_01530) | - | 345696..345953 (+) | 258 | WP_031864864.1 | DUF3310 domain-containing protein | - |
| MUA62_RS01535 (MUA62_01535) | - | 345956..346156 (+) | 201 | WP_252549766.1 | hypothetical protein | - |
| MUA62_RS01540 (MUA62_01540) | - | 346153..346842 (+) | 690 | WP_252549763.1 | N-6 DNA methylase | - |
| MUA62_RS01545 (MUA62_01545) | - | 346856..347062 (+) | 207 | WP_252549760.1 | hypothetical protein | - |
| MUA62_RS01550 (MUA62_01550) | - | 347090..347491 (+) | 402 | WP_262542127.1 | hypothetical protein | - |
| MUA62_RS01555 (MUA62_01555) | - | 347488..347835 (+) | 348 | WP_252570428.1 | YopX family protein | - |
| MUA62_RS01560 (MUA62_01560) | - | 347832..348140 (+) | 309 | WP_398572652.1 | hypothetical protein | - |
| MUA62_RS01565 (MUA62_01565) | - | 348133..348384 (+) | 252 | WP_110166336.1 | DUF1024 family protein | - |
| MUA62_RS01570 (MUA62_01570) | - | 348374..348547 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| MUA62_RS01575 (MUA62_01575) | - | 348548..348829 (+) | 282 | WP_000454994.1 | hypothetical protein | - |
| MUA62_RS01580 (MUA62_01580) | - | 348830..348991 (+) | 162 | WP_000889683.1 | hypothetical protein | - |
| MUA62_RS01585 (MUA62_01585) | - | 349006..349539 (+) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| MUA62_RS01590 (MUA62_01590) | - | 349576..349782 (+) | 207 | WP_033859700.1 | DUF1381 domain-containing protein | - |
| MUA62_RS01595 (MUA62_01595) | rinB | 349779..349928 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MUA62_RS01600 (MUA62_01600) | - | 349928..350128 (+) | 201 | WP_111761860.1 | DUF1514 family protein | - |
| MUA62_RS01605 (MUA62_01605) | - | 350151..350612 (+) | 462 | WP_086037675.1 | hypothetical protein | - |
| MUA62_RS01610 (MUA62_01610) | - | 350727..351179 (+) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| MUA62_RS01615 (MUA62_01615) | - | 351195..351539 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| MUA62_RS01620 (MUA62_01620) | - | 351668..352138 (+) | 471 | WP_262542129.1 | phage terminase small subunit P27 family | - |
| MUA62_RS01625 (MUA62_01625) | - | 352138..353832 (+) | 1695 | WP_086037673.1 | terminase large subunit | - |
| MUA62_RS01630 (MUA62_01630) | - | 353846..354046 (+) | 201 | WP_000365300.1 | hypothetical protein | - |
| MUA62_RS01635 (MUA62_01635) | - | 354052..355302 (+) | 1251 | WP_045178579.1 | phage portal protein | - |
| MUA62_RS01640 (MUA62_01640) | - | 355295..355879 (+) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| MUA62_RS01645 (MUA62_01645) | - | 355967..357214 (+) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| MUA62_RS01650 (MUA62_01650) | - | 357250..357408 (+) | 159 | WP_001252099.1 | hypothetical protein | - |
| MUA62_RS01655 (MUA62_01655) | - | 357417..357749 (+) | 333 | WP_001177483.1 | head-tail connector protein | - |
| MUA62_RS01660 (MUA62_01660) | - | 357736..358071 (+) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| MUA62_RS01665 (MUA62_01665) | - | 358071..358448 (+) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MUA62_RS01670 (MUA62_01670) | - | 358445..358825 (+) | 381 | WP_262542132.1 | hypothetical protein | - |
| MUA62_RS01675 (MUA62_01675) | - | 358826..359779 (+) | 954 | WP_086037669.1 | major tail protein | - |
| MUA62_RS01680 (MUA62_01680) | gpG | 359844..360290 (+) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| MUA62_RS01685 (MUA62_01685) | gpGT | 360350..360472 (+) | 123 | WP_000570353.1 | phage tail assembly chaperone GT | - |
| MUA62_RS01690 (MUA62_01690) | - | 360528..365180 (+) | 4653 | WP_262542135.1 | phage tail tape measure protein | - |
| MUA62_RS01695 (MUA62_01695) | - | 365180..366670 (+) | 1491 | WP_106096714.1 | phage distal tail protein | - |
| MUA62_RS01700 (MUA62_01700) | - | 366686..370471 (+) | 3786 | WP_252549737.1 | phage tail spike protein | - |
| MUA62_RS01705 (MUA62_01705) | - | 370461..370613 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| MUA62_RS01710 (MUA62_01710) | - | 370659..370946 (+) | 288 | WP_162636283.1 | hypothetical protein | - |
| MUA62_RS01715 (MUA62_01715) | - | 371002..371376 (+) | 375 | WP_000340974.1 | hypothetical protein | - |
| MUA62_RS01720 (MUA62_01720) | - | 371503..371940 (+) | 438 | WP_045179064.1 | phage holin | - |
| MUA62_RS01725 (MUA62_01725) | - | 371921..373366 (+) | 1446 | WP_262542137.1 | SH3 domain-containing protein | - |
| MUA62_RS01730 (MUA62_01730) | - | 373595..373897 (+) | 303 | Protein_342 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16035.64 Da Isoelectric Point: 6.9799
>NTDB_id=671777 MUA62_RS01485 WP_197851976.1 341354..341782(+) (ssbA) [Staphylococcus aureus strain IVB6252]
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRVVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLETKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=671777 MUA62_RS01485 WP_197851976.1 341354..341782(+) (ssbA) [Staphylococcus aureus strain IVB6252]
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGGCGACTAACGAAAGACCCTGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAAACGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.302 |
100 |
0.718 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.627 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
74.648 |
0.444 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.357 |
100 |
0.437 |
| ssbA | Streptococcus mutans UA159 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.254 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.549 |
100 |
0.415 |
| ssb | Vibrio cholerae strain A1552 |
30.814 |
100 |
0.373 |