Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MO978_RS07070 | Genome accession | NZ_CP093959 |
| Coordinates | 1415884..1416309 (-) | Length | 141 a.a. |
| NCBI ID | WP_289421631.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain FAM 17919 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1383466..1425430 | 1415884..1416309 | within | 0 |
Gene organization within MGE regions
Location: 1383466..1425430
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MO978_RS06815 (MO978_06820) | - | 1383466..1383996 (-) | 531 | WP_010905913.1 | hypothetical protein | - |
| MO978_RS06825 (MO978_06830) | - | 1385553..1386842 (-) | 1290 | WP_082225228.1 | LysM peptidoglycan-binding domain-containing protein | - |
| MO978_RS06830 (MO978_06835) | - | 1386839..1387105 (-) | 267 | WP_015966839.1 | phage holin | - |
| MO978_RS06835 (MO978_06840) | - | 1387102..1387344 (-) | 243 | WP_082225229.1 | hemolysin XhlA family protein | - |
| MO978_RS06840 (MO978_06845) | - | 1387357..1387593 (-) | 237 | WP_082225230.1 | hypothetical protein | - |
| MO978_RS06845 (MO978_06850) | - | 1387605..1391582 (-) | 3978 | WP_289421638.1 | hypothetical protein | - |
| MO978_RS06850 (MO978_06855) | - | 1391582..1392316 (-) | 735 | WP_289421637.1 | phage tail domain-containing protein | - |
| MO978_RS06855 (MO978_06860) | - | 1392273..1393115 (-) | 843 | WP_373961842.1 | distal tail protein Dit | - |
| MO978_RS06860 (MO978_06865) | - | 1393118..1396039 (-) | 2922 | WP_373961843.1 | tape measure protein | - |
| MO978_RS06865 (MO978_06870) | istB | 1396141..1396899 (-) | 759 | WP_003331414.1 | IS21-like element IS712 family helper ATPase IstB | - |
| MO978_RS06870 (MO978_06875) | istA | 1396911..1398134 (-) | 1224 | WP_003331415.1 | IS21-like element IS712 family transposase | - |
| MO978_RS06875 (MO978_06880) | - | 1398197..1399090 (-) | 894 | WP_373961844.1 | hypothetical protein | - |
| MO978_RS06880 (MO978_06885) | - | 1399108..1399248 (-) | 141 | WP_014573136.1 | hypothetical protein | - |
| MO978_RS06885 (MO978_06890) | - | 1399296..1399640 (-) | 345 | WP_010905385.1 | phage tail assembly chaperone | - |
| MO978_RS06890 (MO978_06895) | - | 1399700..1400305 (-) | 606 | WP_010905384.1 | phage tail protein | - |
| MO978_RS06895 (MO978_06900) | - | 1400307..1400702 (-) | 396 | WP_010905383.1 | DUF806 family protein | - |
| MO978_RS06900 (MO978_06905) | - | 1400699..1401181 (-) | 483 | WP_021214764.1 | HK97 gp10 family phage protein | - |
| MO978_RS06905 (MO978_06910) | - | 1401181..1401516 (-) | 336 | WP_010905381.1 | phage head closure protein | - |
| MO978_RS06910 (MO978_06915) | - | 1401503..1401808 (-) | 306 | WP_010905380.1 | head-tail connector protein | - |
| MO978_RS06915 (MO978_06920) | - | 1401819..1403132 (-) | 1314 | WP_058221420.1 | phage major capsid protein | - |
| MO978_RS06920 (MO978_06925) | - | 1403122..1403709 (-) | 588 | WP_010905378.1 | HK97 family phage prohead protease | - |
| MO978_RS06925 (MO978_06930) | - | 1403709..1404851 (-) | 1143 | WP_373961847.1 | phage portal protein | - |
| MO978_RS06930 | - | 1404922..1405239 (-) | 318 | WP_228764164.1 | terminase large subunit domain-containing protein | - |
| MO978_RS06935 (MO978_06940) | - | 1405353..1405553 (-) | 201 | WP_058221648.1 | hypothetical protein | - |
| MO978_RS06940 (MO978_06945) | - | 1405553..1406005 (-) | 453 | WP_014573149.1 | phage terminase small subunit P27 family | - |
| MO978_RS06945 (MO978_06950) | - | 1406122..1406625 (-) | 504 | WP_058221813.1 | HNH endonuclease | - |
| MO978_RS06950 (MO978_06955) | - | 1406631..1406867 (-) | 237 | WP_058221812.1 | hypothetical protein | - |
| MO978_RS06955 (MO978_06960) | - | 1407156..1407578 (-) | 423 | WP_032398555.1 | RinA family protein | - |
| MO978_RS06960 (MO978_06965) | - | 1407655..1407963 (-) | 309 | WP_019292848.1 | hypothetical protein | - |
| MO978_RS06965 (MO978_06970) | - | 1408302..1408511 (+) | 210 | WP_010905366.1 | hypothetical protein | - |
| MO978_RS06970 (MO978_06975) | - | 1408564..1408749 (-) | 186 | WP_010905365.1 | hypothetical protein | - |
| MO978_RS06975 (MO978_06980) | - | 1408757..1409248 (-) | 492 | WP_032398552.1 | phage antirepressor KilAC domain-containing protein | - |
| MO978_RS06980 (MO978_06985) | - | 1409257..1409487 (-) | 231 | WP_032398551.1 | hypothetical protein | - |
| MO978_RS06985 (MO978_06990) | - | 1409484..1409669 (-) | 186 | WP_058221669.1 | DUF1660 family phage protein | - |
| MO978_RS06990 (MO978_06995) | - | 1409666..1409908 (-) | 243 | WP_014570545.1 | hypothetical protein | - |
| MO978_RS06995 (MO978_07000) | - | 1409955..1410119 (-) | 165 | WP_010905701.1 | hypothetical protein | - |
| MO978_RS07000 (MO978_07005) | - | 1410112..1410486 (-) | 375 | WP_058221807.1 | hypothetical protein | - |
| MO978_RS07005 (MO978_07010) | - | 1410479..1410742 (-) | 264 | WP_029344171.1 | hypothetical protein | - |
| MO978_RS07010 (MO978_07015) | - | 1410735..1411136 (-) | 402 | WP_153951833.1 | hypothetical protein | - |
| MO978_RS07015 (MO978_07020) | - | 1411139..1411558 (-) | 420 | WP_058221808.1 | dUTP diphosphatase | - |
| MO978_RS07020 (MO978_07025) | - | 1411555..1412166 (-) | 612 | WP_058221809.1 | DUF1642 domain-containing protein | - |
| MO978_RS07025 (MO978_07030) | - | 1412159..1412518 (-) | 360 | WP_082225233.1 | hypothetical protein | - |
| MO978_RS07030 (MO978_07035) | - | 1412527..1413036 (-) | 510 | WP_289452771.1 | hypothetical protein | - |
| MO978_RS07035 (MO978_07040) | - | 1413047..1413616 (-) | 570 | WP_373961849.1 | DUF658 family protein | - |
| MO978_RS07040 (MO978_07045) | - | 1413606..1413785 (-) | 180 | WP_058221659.1 | DUF1497 domain-containing protein | - |
| MO978_RS07045 (MO978_07050) | - | 1413897..1414136 (-) | 240 | WP_082225234.1 | DUF1031 family protein | - |
| MO978_RS07050 (MO978_07055) | - | 1414129..1414323 (-) | 195 | WP_010905693.1 | hypothetical protein | - |
| MO978_RS07055 (MO978_07060) | - | 1414326..1414715 (-) | 390 | WP_081196279.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MO978_RS07060 (MO978_07065) | - | 1414705..1414977 (-) | 273 | WP_058221674.1 | hypothetical protein | - |
| MO978_RS07065 (MO978_07070) | - | 1414961..1415755 (-) | 795 | WP_289421633.1 | helix-turn-helix domain-containing protein | - |
| MO978_RS07070 (MO978_07075) | ssb | 1415884..1416309 (-) | 426 | WP_289421631.1 | single-stranded DNA-binding protein | Machinery gene |
| MO978_RS07075 (MO978_07080) | - | 1416302..1417060 (-) | 759 | WP_015967986.1 | Rad52/Rad22 family DNA repair protein | - |
| MO978_RS07080 (MO978_07085) | - | 1417069..1417464 (-) | 396 | WP_058221458.1 | hypothetical protein | - |
| MO978_RS07085 (MO978_07090) | - | 1417563..1417805 (-) | 243 | WP_058221457.1 | hypothetical protein | - |
| MO978_RS07090 (MO978_07095) | - | 1417911..1418189 (+) | 279 | WP_011834777.1 | hypothetical protein | - |
| MO978_RS07095 (MO978_07100) | - | 1418144..1418377 (-) | 234 | WP_011834776.1 | hypothetical protein | - |
| MO978_RS07100 (MO978_07105) | - | 1418520..1418810 (-) | 291 | WP_023188819.1 | phage protein | - |
| MO978_RS07105 (MO978_07110) | - | 1418823..1419586 (-) | 764 | Protein_1378 | phage antirepressor KilAC domain-containing protein | - |
| MO978_RS07110 (MO978_07115) | - | 1419599..1419838 (-) | 240 | WP_058218152.1 | helix-turn-helix transcriptional regulator | - |
| MO978_RS07115 (MO978_07120) | - | 1419990..1420688 (+) | 699 | WP_058221742.1 | hypothetical protein | - |
| MO978_RS07120 (MO978_07125) | - | 1420681..1420914 (-) | 234 | WP_058221741.1 | hypothetical protein | - |
| MO978_RS07125 (MO978_07130) | - | 1421178..1421696 (+) | 519 | WP_058221740.1 | helix-turn-helix domain-containing protein | - |
| MO978_RS07130 (MO978_07135) | - | 1421706..1422293 (+) | 588 | WP_058221739.1 | hypothetical protein | - |
| MO978_RS07135 (MO978_07140) | - | 1422358..1423188 (+) | 831 | WP_228763241.1 | hypothetical protein | - |
| MO978_RS07140 (MO978_07145) | - | 1423311..1424390 (+) | 1080 | WP_058221500.1 | site-specific integrase | - |
| MO978_RS07150 (MO978_07155) | - | 1425095..1425430 (-) | 336 | WP_003130477.1 | putative DNA-binding protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15658.39 Da Isoelectric Point: 5.1972
>NTDB_id=665936 MO978_RS07070 WP_289421631.1 1415884..1416309(-) (ssb) [Lactococcus lactis strain FAM 17919]
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRIYITEVVASNFQVLEKSNQANGERVGNPAAKPQNNDSFGSDPMEISDDDLPF
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRIYITEVVASNFQVLEKSNQANGERVGNPAAKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=665936 MO978_RS07070 WP_289421631.1 1415884..1416309(-) (ssb) [Lactococcus lactis strain FAM 17919]
ATGATTAACAATGTCACTCTAGTAGGGCGAATTACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATCGGAGTTACTGGTAGTATTCAAACTCGA
AACTACGAGAACCAACAAGGGCAACGTATTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTGGTAATCCAGCAGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
ATGATTAACAATGTCACTCTAGTAGGGCGAATTACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATCGGAGTTACTGGTAGTATTCAAACTCGA
AACTACGAGAACCAACAAGGGCAACGTATTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTGGTAATCCAGCAGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.652 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.744 |
100 |
0.631 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.731 |
73.759 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
39.716 |
100 |
0.397 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
50.485 |
73.05 |
0.369 |