Detailed information NTG0665578

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: MOW09_RS10910
• Genome accession: NZ_CP093928
• Coordinates: 2097361..2097696 (+)
• Length: 111 a.a.
• NCBI ID: WP_000982018.1
• Uniprot ID: A0A9W5VT75
• Organism: Bacillus cereus strain AH7-7
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2084454..2097696	2097361..2097696	within	0

Gene organization within MGE regions

Location: 2084454..2097696

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MOW09_RS10850 (MOW09_10850)	-	2084454..2085561 (+)	1108	Protein_2061	tyrosine-type recombinase/integrase	-
MOW09_RS29520	-	2086461..2087075 (+)	615	WP_345742866.1	tyrosine-type recombinase/integrase	-
MOW09_RS29525	-	2087090..2087221 (+)	132	WP_345742867.1	tyrosine-type recombinase/integrase	-
MOW09_RS10860 (MOW09_10860)	-	2087706..2088087 (+)	382	Protein_2064	DUF6262 family protein	-
MOW09_RS10865 (MOW09_10865)	-	2089266..2090309 (+)	1044	WP_011040467.1	collagen-like protein	-
MOW09_RS10870 (MOW09_10870)	-	2090423..2090767 (+)	345	WP_017562367.1	S-Ena type endospore appendage	-
MOW09_RS10875 (MOW09_10875)	-	2091110..2092183 (+)	1074	WP_000109855.1	tetratricopeptide repeat protein	-
MOW09_RS10880 (MOW09_10880)	-	2092180..2092305 (+)	126	WP_000709201.1	aspartate phosphatase	-
MOW09_RS10885 (MOW09_10885)	-	2092601..2093383 (-)	783	WP_065382441.1	hypothetical protein	-
MOW09_RS10890 (MOW09_10890)	-	2093493..2094140 (+)	648	WP_065382442.1	HD domain-containing protein	-
MOW09_RS10895 (MOW09_10895)	-	2094137..2096032 (+)	1896	WP_000783160.1	ABC-F family ATP-binding cassette domain-containing protein	-
MOW09_RS10900 (MOW09_10900)	-	2096108..2096839 (+)	732	WP_001260655.1	Bax inhibitor-1/YccA family protein	-
MOW09_RS10905 (MOW09_10905)	-	2096945..2097199 (+)	255	WP_000975138.1	DUF4318 domain-containing protein	-
MOW09_RS10910 (MOW09_10910)	ssbA	2097361..2097696 (+)	336	WP_000982018.1	single-stranded DNA-binding protein	Machinery gene

Sequence

Protein

• Length: 111 a.a.
• Molecular weight: 12771.61 Da
• Isoelectric Point: 9.4344

>NTDB_id=665578 MOW09_RS10910 WP_000982018.1 2097361..2097696(+) (ssbA) [Bacillus cereus strain AH7-7]
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS
NYDDEQGKRIYRTEVVIESITFLERRREGAS

Nucleotide

• Length: 336 bp

>NTDB_id=665578 MOW09_RS10910 WP_000982018.1 2097361..2097696(+) (ssbA) [Bacillus cereus strain AH7-7]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGCAAATCGGCTGAGAATGTAACTGAATATTGTAAAAAGGGATCACTCGTTGGGATTACAGGGCGTATTCAGACTAGT
AATTACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCGTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	58.491	95.495	0.559
ssb	Latilactobacillus sakei subsp. sakei 23K	55.66	95.495	0.532
ssbB	Bacillus subtilis subsp. subtilis str. 168	50.893	100	0.514
ssbB	Lactococcus lactis subsp. cremoris KW2	45.714	94.595	0.432
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.636	99.099	0.432
ssbA	Streptococcus mutans UA159	40	99.099	0.396
ssbB/cilA	Streptococcus mitis NCTC 12261	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae TIGR4	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae D39	39.091	99.099	0.387
ssbB/cilA	Streptococcus pneumoniae R6	39.091	99.099	0.387
ssbB/cilA	Streptococcus mitis SK321	39.091	99.099	0.387
ssbB/cilA	Streptococcus pneumoniae Rx1	39.091	99.099	0.387