Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MNO09_RS20025 | Genome accession | NZ_CP093325 |
| Coordinates | 3411087..3411425 (-) | Length | 112 a.a. |
| NCBI ID | WP_088107121.1 | Uniprot ID | A0A2B6RSE9 |
| Organism | Bacillus sp. N5-665 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3411087..3442818 | 3411087..3411425 | within | 0 |
Gene organization within MGE regions
Location: 3411087..3442818
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MNO09_RS20025 (MNO09_19905) | ssb | 3411087..3411425 (-) | 339 | WP_088107121.1 | single-stranded DNA-binding protein | Machinery gene |
| MNO09_RS20030 (MNO09_19910) | - | 3411584..3411838 (-) | 255 | WP_000975142.1 | DUF4318 domain-containing protein | - |
| MNO09_RS20035 (MNO09_19915) | - | 3411993..3412724 (-) | 732 | WP_001260655.1 | Bax inhibitor-1/YccA family protein | - |
| MNO09_RS20040 (MNO09_19920) | - | 3412800..3414695 (-) | 1896 | WP_000783182.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| MNO09_RS20045 (MNO09_19925) | - | 3414692..3415339 (-) | 648 | WP_000165957.1 | HD domain-containing protein | - |
| MNO09_RS20050 (MNO09_19930) | - | 3415449..3416270 (+) | 822 | WP_088107120.1 | hypothetical protein | - |
| MNO09_RS20055 (MNO09_19935) | - | 3416573..3417845 (-) | 1273 | Protein_3521 | XkdF-like putative serine protease domain-containing protein | - |
| MNO09_RS20060 (MNO09_19940) | - | 3417959..3418477 (-) | 519 | WP_241950201.1 | phage minor head protein | - |
| MNO09_RS20065 (MNO09_19945) | - | 3418591..3420070 (-) | 1480 | Protein_3523 | phage portal protein | - |
| MNO09_RS20070 (MNO09_19950) | - | 3420286..3421137 (+) | 852 | WP_241950045.1 | exosporium leader peptide-containing protein | - |
| MNO09_RS20075 (MNO09_19955) | - | 3421344..3422625 (-) | 1282 | Protein_3525 | PBSX family phage terminase large subunit | - |
| MNO09_RS20080 (MNO09_19960) | terS | 3422618..3423442 (-) | 825 | WP_088107118.1 | phage terminase small subunit | - |
| MNO09_RS20085 (MNO09_19965) | - | 3423464..3423643 (-) | 180 | WP_000390758.1 | hypothetical protein | - |
| MNO09_RS20090 (MNO09_19970) | - | 3423762..3423965 (+) | 204 | WP_080014171.1 | hypothetical protein | - |
| MNO09_RS20095 (MNO09_19975) | - | 3423978..3424202 (+) | 225 | WP_000265596.1 | hypothetical protein | - |
| MNO09_RS20100 (MNO09_19980) | - | 3424298..3424840 (-) | 543 | WP_000673904.1 | site-specific integrase | - |
| MNO09_RS20105 (MNO09_19985) | - | 3425029..3425172 (+) | 144 | WP_229181210.1 | DUF3956 family protein | - |
| MNO09_RS20110 (MNO09_19990) | - | 3426114..3426809 (+) | 696 | WP_001294973.1 | CsxC family protein | - |
| MNO09_RS20115 (MNO09_19995) | - | 3427012..3427266 (-) | 255 | WP_033657800.1 | hypothetical protein | - |
| MNO09_RS20120 (MNO09_20000) | - | 3427720..3428346 (+) | 627 | WP_000069270.1 | hypothetical protein | - |
| MNO09_RS20125 (MNO09_20005) | - | 3428600..3429142 (-) | 543 | WP_001012158.1 | site-specific integrase | - |
| MNO09_RS20130 (MNO09_20010) | - | 3429142..3429624 (-) | 483 | WP_000166159.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MNO09_RS20135 (MNO09_20015) | - | 3429649..3429819 (-) | 171 | WP_000866149.1 | hypothetical protein | - |
| MNO09_RS20140 (MNO09_20020) | - | 3429979..3430635 (-) | 657 | WP_000431217.1 | hypothetical protein | - |
| MNO09_RS20145 (MNO09_20025) | - | 3432223..3433539 (+) | 1317 | WP_088107116.1 | collagen-like protein | - |
| MNO09_RS20150 (MNO09_20030) | - | 3434047..3434712 (+) | 666 | WP_086398573.1 | exosporium leader peptide-containing protein | - |
| MNO09_RS20155 (MNO09_20035) | - | 3435007..3435873 (+) | 867 | WP_000796374.1 | hypothetical protein | - |
| MNO09_RS20160 (MNO09_20040) | - | 3436427..3437920 (+) | 1494 | WP_241950046.1 | exosporium leader peptide-containing protein | - |
| MNO09_RS20165 (MNO09_20045) | - | 3438093..3438284 (-) | 192 | WP_000511362.1 | DUF3954 domain-containing protein | - |
| MNO09_RS20170 (MNO09_20050) | - | 3438356..3438718 (-) | 363 | WP_001125993.1 | hypothetical protein | - |
| MNO09_RS20175 (MNO09_20055) | - | 3438729..3439736 (-) | 1008 | WP_061673109.1 | DnaD domain protein | - |
| MNO09_RS20180 (MNO09_20060) | - | 3439854..3440078 (-) | 225 | WP_000161462.1 | hypothetical protein | - |
| MNO09_RS20185 (MNO09_20065) | - | 3440064..3440360 (+) | 297 | Protein_3547 | ImmA/IrrE family metallo-endopeptidase | - |
| MNO09_RS20190 (MNO09_20070) | - | 3440381..3441517 (+) | 1137 | WP_000678744.1 | site-specific integrase | - |
| MNO09_RS20195 (MNO09_20075) | - | 3442318..3442818 (+) | 501 | WP_000069070.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 112 a.a. Molecular weight: 12922.86 Da Isoelectric Point: 9.4109
>NTDB_id=663613 MNO09_RS20025 WP_088107121.1 3411087..3411425(-) (ssb) [Bacillus sp. N5-665]
MMNRVVLIGRLTKEPELYYTKQSVAYARICVAVNKGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIHTR
NYEDDQGKRIYITEVLIESITFLEKRREGASQ
MMNRVVLIGRLTKEPELYYTKQSVAYARICVAVNKGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIHTR
NYEDDQGKRIYITEVLIESITFLEKRREGASQ
Nucleotide
Download Length: 339 bp
>NTDB_id=663613 MNO09_RS20025 WP_088107121.1 3411087..3411425(-) (ssb) [Bacillus sp. N5-665]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAGCAAAGTGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAAAGGTTTTCGAAATAGTTTAGGTGAGCAACAAGTAGATTTTATTAATTGTGTCGTTT
GGAGAAAATCGGCTGAGAATGTAACTGAATATTGTAAGAAGGGGTCACTTGTTGGAATTACCGGACGTATTCATACGAGG
AATTACGAGGATGATCAAGGAAAGAGAATATATATAACGGAAGTTCTGATTGAGAGCATTACATTTTTGGAGAAAAGGCG
GGAGGGGGCATCGCAATAA
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAGCAAAGTGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAAAGGTTTTCGAAATAGTTTAGGTGAGCAACAAGTAGATTTTATTAATTGTGTCGTTT
GGAGAAAATCGGCTGAGAATGTAACTGAATATTGTAAGAAGGGGTCACTTGTTGGAATTACCGGACGTATTCATACGAGG
AATTACGAGGATGATCAAGGAAAGAGAATATATATAACGGAAGTTCTGATTGAGAGCATTACATTTTTGGAGAAAAGGCG
GGAGGGGGCATCGCAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.261 |
100 |
0.545 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
94.643 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
50.442 |
100 |
0.509 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.364 |
98.214 |
0.455 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
47.619 |
93.75 |
0.446 |
| ssbA | Streptococcus mutans UA159 |
42.727 |
98.214 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.909 |
98.214 |
0.402 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.909 |
98.214 |
0.402 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.909 |
98.214 |
0.402 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.909 |
98.214 |
0.402 |