NTDB

Overview

Name	ssbB	Type	Machinery gene
Locus tag	MN092_RS21110	Genome accession	NZ_CP093290
Coordinates	4084598..4084945 (-)	Length	115 a.a.
NCBI ID	WP_061565986.1	Uniprot ID	A0A8B5YAR4
Organism	Bacillus licheniformis strain DSM 13
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 4079598..4089945

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MN092_RS21080 (MN092_21080)	srlD	4080208..4080993 (-)	786	WP_003185881.1	sorbitol-6-phosphate dehydrogenase	-
MN092_RS21085 (MN092_21085)	-	4081008..4081379 (-)	372	WP_003185882.1	PTS glucitol/sorbitol transporter subunit IIA	-
MN092_RS21090 (MN092_21090)	-	4081404..4082411 (-)	1008	WP_061565984.1	PTS glucitol/sorbitol transporter subunit IIB	-
MN092_RS21095 (MN092_21095)	-	4082429..4082977 (-)	549	WP_061565985.1	PTS glucitol/sorbitol transporter subunit IIC	-
MN092_RS21100 (MN092_21100)	-	4082974..4083417 (-)	444	WP_003185888.1	transcriptional regulator GutM	-
MN092_RS21105 (MN092_21105)	-	4083414..4084376 (-)	963	WP_003185891.1	sugar-binding transcriptional regulator	-
MN092_RS21110 (MN092_21110)	ssbB	4084598..4084945 (-)	348	WP_061565986.1	single-stranded DNA-binding protein	Machinery gene
MN092_RS21115 (MN092_21115)	-	4085051..4085422 (-)	372	WP_003185895.1	hypothetical protein	-
MN092_RS21120 (MN092_21120)	-	4085604..4086017 (+)	414	WP_003185898.1	YwpF-like family protein	-
MN092_RS21125 (MN092_21125)	mscL	4086058..4086438 (-)	381	WP_061565987.1	large conductance mechanosensitive channel protein MscL	-
MN092_RS21130 (MN092_21130)	fabZ	4086508..4086942 (-)	435	WP_003185902.1	3-hydroxyacyl-ACP dehydratase FabZ	-
MN092_RS21135 (MN092_21135)	-	4087136..4087963 (-)	828	WP_003185904.1	flagellar hook-basal body protein	-
MN092_RS21140 (MN092_21140)	-	4088007..4088846 (-)	840	WP_003185907.1	flagellar hook-basal body protein	-

Sequence

Protein

Download Length: 115 a.a. Molecular weight: 12767.47 Da Isoelectric Point: 6.9538

                                >NTDB_id=663094 MN092_RS21110 WP_061565986.1 4084598..4084945(-) (ssbB) [Bacillus licheniformis strain DSM 13]

MFNEIMLVGRLTKDPELRYTSDGVPVANVTLAVSRPFKNAAGEVEADFVNCTLWRKTAVNTAEYCEKGSIIGLSGRIQTR

QYVNSEGERTFITEVVARTVRFLGESRKAHEPADA

Nucleotide

Download Length: 348 bp

                                >NTDB_id=663094 MN092_RS21110 WP_061565986.1 4084598..4084945(-) (ssbB) [Bacillus licheniformis strain DSM 13]

ATGTTTAATGAGATCATGCTCGTCGGGCGTTTGACAAAAGATCCCGAACTGCGGTATACATCTGACGGTGTCCCTGTTGC

AAATGTGACGCTGGCTGTCAGCAGGCCTTTCAAGAACGCAGCAGGCGAAGTAGAAGCGGACTTTGTCAATTGCACTCTAT

GGCGCAAAACTGCCGTGAACACAGCCGAATATTGCGAAAAAGGCTCCATCATCGGGCTGAGCGGAAGAATCCAGACCCGC

CAATACGTCAATTCAGAAGGCGAACGCACCTTTATTACAGAAGTTGTCGCCCGGACAGTCAGATTTTTGGGAGAAAGCCG

GAAAGCGCATGAGCCGGCTGATGCTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A8B5YAR4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB	Bacillus subtilis subsp. subtilis str. 168	71.845	89.565	0.643
ssbA	Bacillus subtilis subsp. subtilis str. 168	58.252	89.565	0.522
ssb	Latilactobacillus sakei subsp. sakei 23K	51.351	96.522	0.496
ssbA	Streptococcus mutans UA159	44.86	93.043	0.417
ssbB/cilA	Streptococcus mitis NCTC 12261	42.991	93.043	0.4
ssbB	Streptococcus sobrinus strain NIDR 6715-7	42.991	93.043	0.4
ssbB/cilA	Streptococcus pneumoniae TIGR4	42.991	93.043	0.4
ssbB	Lactococcus lactis subsp. cremoris KW2	43.396	92.174	0.4
ssbB/cilA	Streptococcus mitis SK321	42.056	93.043	0.391
ssbB/cilA	Streptococcus pneumoniae Rx1	42.056	93.043	0.391
ssbB/cilA	Streptococcus pneumoniae D39	42.056	93.043	0.391
ssbB/cilA	Streptococcus pneumoniae R6	42.056	93.043	0.391

Detailed information NTG0663094