NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	MK801_RS00785	Genome accession	NZ_CP092748
Coordinates	164337..164720 (+)	Length	127 a.a.
NCBI ID	WP_080651958.1	Uniprot ID	-
Organism	Lactococcus lactis strain 17M1
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 159337..169720

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MK801_RS00770 (MK801_00770)	-	161807..162148 (+)	342	WP_240664866.1	hypothetical protein	-
MK801_RS00775 (MK801_00775)	comGA	162418..163356 (+)	939	Protein_135	competence type IV pilus ATPase ComGA	-
MK801_RS00780 (MK801_00780)	comGB	163250..164323 (+)	1074	WP_080619357.1	competence type IV pilus assembly protein ComGB	Machinery gene
MK801_RS00785 (MK801_00785)	comGC	164337..164720 (+)	384	WP_080651958.1	competence type IV pilus major pilin ComGC	Machinery gene
MK801_RS00790 (MK801_00790)	comGD	164695..165111 (+)	417	WP_240664867.1	competence type IV pilus minor pilin ComGD	Machinery gene
MK801_RS00795 (MK801_00795)	comGE	165083..165379 (+)	297	WP_015427164.1	competence type IV pilus minor pilin ComGE	Machinery gene
MK801_RS00800 (MK801_00800)	comGF	165342..165788 (+)	447	WP_057720549.1	competence type IV pilus minor pilin ComGF	Machinery gene
MK801_RS00805 (MK801_00805)	comGG	165836..166111 (+)	276	WP_240758564.1	competence protein ComGG	Machinery gene
MK801_RS00810 (MK801_00810)	-	166193..166630 (+)	438	WP_010906313.1	zinc-dependent MarR family transcriptional regulator	-
MK801_RS00815 (MK801_00815)	-	166627..167469 (+)	843	WP_015427160.1	metal ABC transporter substrate-binding protein	-
MK801_RS00820 (MK801_00820)	-	167646..168383 (+)	738	WP_015427159.1	metal ABC transporter ATP-binding protein	-
MK801_RS00825 (MK801_00825)	-	168376..169185 (+)	810	WP_014570791.1	metal ABC transporter permease	-

Sequence

Protein

Download Length: 127 a.a. Molecular weight: 14811.42 Da Isoelectric Point: 8.4538

                                >NTDB_id=659949 MK801_RS00785 WP_080651958.1 164337..164720(+) (comGC) [Lactococcus lactis strain 17M1]

MERTKKFILKKIQKIFLFVKICEKKCRQKELKAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQA

QLYELDHDDEKPTLSELLSAGMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

Download Length: 384 bp

                                >NTDB_id=659949 MK801_RS00785 WP_080651958.1 164337..164720(+) (comGC) [Lactococcus lactis strain 17M1]

ATGGAAAGAACAAAGAAGTTTATTTTAAAGAAAATACAAAAAATATTTTTATTCGTTAAAATTTGTGAAAAAAAATGCCG

TCAGAAAGAGCTAAAAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTG

TTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCC

CAACTTTATGAATTAGATCATGATGATGAGAAGCCGACTCTGTCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACA

AATTTCTGCTTACGATAATTACTATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(32-52)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Lactococcus lactis subsp. cremoris KW2	81.034	91.339	0.74
comYC	Streptococcus mutans UA159	56.436	79.528	0.449
comYC	Streptococcus mutans UA140	56.436	79.528	0.449
comYC	Streptococcus gordonii str. Challis substr. CH1	57.576	77.953	0.449
comGC/cglC	Streptococcus mitis SK321	55.446	79.528	0.441
comGC/cglC	Streptococcus pneumoniae TIGR4	53.465	79.528	0.425
comGC/cglC	Streptococcus pneumoniae Rx1	53.465	79.528	0.425
comGC/cglC	Streptococcus pneumoniae D39	53.465	79.528	0.425
comGC/cglC	Streptococcus pneumoniae R6	53.465	79.528	0.425
comYC	Streptococcus suis isolate S10	57.955	69.291	0.402
comGC/cglC	Streptococcus mitis NCTC 12261	57.303	70.079	0.402

Detailed information NTG0659949