Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MK801_RS00805 Genome accession   NZ_CP092748
Coordinates   165836..166111 (+) Length   91 a.a.
NCBI ID   WP_240758564.1    Uniprot ID   -
Organism   Lactococcus lactis strain 17M1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 160836..171111
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MK801_RS00770 (MK801_00770) - 161807..162148 (+) 342 WP_240664866.1 hypothetical protein -
  MK801_RS00775 (MK801_00775) comGA 162418..163356 (+) 939 Protein_135 competence type IV pilus ATPase ComGA -
  MK801_RS00780 (MK801_00780) comGB 163250..164323 (+) 1074 WP_080619357.1 competence type IV pilus assembly protein ComGB Machinery gene
  MK801_RS00785 (MK801_00785) comGC 164337..164720 (+) 384 WP_080651958.1 competence type IV pilus major pilin ComGC Machinery gene
  MK801_RS00790 (MK801_00790) comGD 164695..165111 (+) 417 WP_240664867.1 competence type IV pilus minor pilin ComGD Machinery gene
  MK801_RS00795 (MK801_00795) comGE 165083..165379 (+) 297 WP_015427164.1 competence type IV pilus minor pilin ComGE Machinery gene
  MK801_RS00800 (MK801_00800) comGF 165342..165788 (+) 447 WP_057720549.1 competence type IV pilus minor pilin ComGF Machinery gene
  MK801_RS00805 (MK801_00805) comGG 165836..166111 (+) 276 WP_240758564.1 competence protein ComGG Machinery gene
  MK801_RS00810 (MK801_00810) - 166193..166630 (+) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  MK801_RS00815 (MK801_00815) - 166627..167469 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  MK801_RS00820 (MK801_00820) - 167646..168383 (+) 738 WP_015427159.1 metal ABC transporter ATP-binding protein -
  MK801_RS00825 (MK801_00825) - 168376..169185 (+) 810 WP_014570791.1 metal ABC transporter permease -
  MK801_RS00830 (MK801_00830) - 169223..170089 (-) 867 WP_057720547.1 RluA family pseudouridine synthase -
  MK801_RS00835 (MK801_00835) - 170293..170670 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence

Protein


Download         Length: 91 a.a.        Molecular weight: 10420.58 Da        Isoelectric Point: 5.0604

>NTDB_id=659953 MK801_RS00805 WP_240758564.1 165836..166111(+) (comGG) [Lactococcus lactis strain 17M1]
MFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQFSIH
LKDGTSFQIKN

Nucleotide


Download         Length: 276 bp        

>NTDB_id=659953 MK801_RS00805 WP_240758564.1 165836..166111(+) (comGG) [Lactococcus lactis strain 17M1]
ATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTTAACAGCTGA
ATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATTTGTCCTACA
ATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTTAGTATCCAT
CTAAAAGATGGCACAAGCTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.889

98.901

0.582