Detailed information NTG0654578

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: L5I20_RS05955
• Genome accession: NZ_CP091904
• Coordinates: 1174792..1175067 (+)
• Length: 91 a.a.
• NCBI ID: WP_002364235.1
• Uniprot ID: -
• Organism: Enterococcus faecalis strain 43-2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1169792..1180067

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L5I20_RS05935 (L5I20_05935)	rlmN	1169889..1170962 (+)	1074	WP_002384342.1	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	-
L5I20_RS05940 (L5I20_05940)	-	1171252..1172580 (+)	1329	WP_238461532.1	APC family permease	-
L5I20_RS05945 (L5I20_05945)	comGA	1172821..1173789 (+)	969	WP_002364237.1	competence type IV pilus ATPase ComGA	-
L5I20_RS05950 (L5I20_05950)	comGB	1173746..1174792 (+)	1047	WP_002384344.1	competence type IV pilus assembly protein ComGB	-
L5I20_RS05955 (L5I20_05955)	comGC/cglC	1174792..1175067 (+)	276	WP_002364235.1	competence type IV pilus major pilin ComGC	Machinery gene
L5I20_RS05960 (L5I20_05960)	comGD	1175064..1175510 (+)	447	WP_002366895.1	competence type IV pilus minor pilin ComGD	-
L5I20_RS05965 (L5I20_05965)	-	1175476..1175802 (+)	327	WP_002370967.1	type II secretion system protein	-
L5I20_RS05970 (L5I20_05970)	comGF	1175792..1176226 (+)	435	WP_002357060.1	competence type IV pilus minor pilin ComGF	-
L5I20_RS05975 (L5I20_05975)	comGG	1176226..1176579 (+)	354	WP_002360027.1	competence type IV pilus minor pilin ComGG	-
L5I20_RS05980 (L5I20_05980)	-	1176708..1177715 (+)	1008	WP_002357063.1	class I SAM-dependent methyltransferase	-
L5I20_RS05985 (L5I20_05985)	-	1177740..1178927 (+)	1188	WP_002357064.1	acetate/propionate family kinase	-
L5I20_RS05990 (L5I20_05990)	-	1179039..1179512 (-)	474	WP_002357065.1	universal stress protein	-
L5I20_RS05995 (L5I20_05995)	-	1179690..1179968 (-)	279	WP_002380425.1	hypothetical protein	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10506.50 Da
• Isoelectric Point: 9.6586

>NTDB_id=654578 L5I20_RS05955 WP_002364235.1 1174792..1175067(+) (comGC/cglC) [Enterococcus faecalis strain 43-2]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ

Nucleotide

• Length: 276 bp

>NTDB_id=654578 L5I20_RS05955 WP_002364235.1 1174792..1175067(+) (comGC/cglC) [Enterococcus faecalis strain 43-2]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae D39	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae R6	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae TIGR4	63.095	92.308	0.582
comGC/cglC	Streptococcus mitis NCTC 12261	61.905	92.308	0.571
comGC/cglC	Streptococcus mitis SK321	61.176	93.407	0.571
comGC	Lactococcus lactis subsp. cremoris KW2	58.14	94.505	0.549
comYC	Streptococcus gordonii str. Challis substr. CH1	56.322	95.604	0.538
comYC	Streptococcus suis isolate S10	52.326	94.505	0.495
comYC	Streptococcus mutans UA159	57.692	85.714	0.495
comYC	Streptococcus mutans UA140	57.692	85.714	0.495
comGC	Latilactobacillus sakei subsp. sakei 23K	46.154	100	0.462
comGC	Staphylococcus aureus MW2	48.101	86.813	0.418
comGC	Staphylococcus aureus N315	48.101	86.813	0.418
comGC	Bacillus subtilis subsp. subtilis str. 168	48.649	81.319	0.396