Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | L5I17_RS09710 | Genome accession | NZ_CP091901 |
| Coordinates | 1971247..1971522 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 59 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1966247..1976522
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L5I17_RS09675 (L5I17_09675) | - | 1966796..1967269 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| L5I17_RS09680 (L5I17_09680) | - | 1967387..1968574 (-) | 1188 | WP_002357064.1 | acetate kinase | - |
| L5I17_RS09685 (L5I17_09685) | - | 1968599..1969606 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| L5I17_RS09690 (L5I17_09690) | comGG | 1969735..1970088 (-) | 354 | WP_002377063.1 | competence type IV pilus minor pilin ComGG | - |
| L5I17_RS09695 (L5I17_09695) | comGF | 1970088..1970522 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| L5I17_RS09700 (L5I17_09700) | - | 1970512..1970838 (-) | 327 | WP_010712601.1 | type II secretion system protein | - |
| L5I17_RS09705 (L5I17_09705) | comGD | 1970804..1971250 (-) | 447 | WP_002366895.1 | competence type IV pilus minor pilin ComGD | - |
| L5I17_RS09710 (L5I17_09710) | comGC/cglC | 1971247..1971522 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| L5I17_RS09715 (L5I17_09715) | comGB | 1971522..1972568 (-) | 1047 | WP_002377060.1 | competence type IV pilus assembly protein ComGB | - |
| L5I17_RS09720 (L5I17_09720) | comGA | 1972525..1973493 (-) | 969 | WP_010712613.1 | competence type IV pilus ATPase ComGA | - |
| L5I17_RS09725 (L5I17_09725) | - | 1973733..1975046 (-) | 1314 | WP_238468034.1 | amino acid permease | - |
| L5I17_RS09730 (L5I17_09730) | rlmN | 1975337..1976410 (-) | 1074 | WP_002377054.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=654550 L5I17_RS09710 WP_002356991.1 1971247..1971522(-) (comGC/cglC) [Enterococcus faecalis strain 59]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=654550 L5I17_RS09710 WP_002356991.1 1971247..1971522(-) (comGC/cglC) [Enterococcus faecalis strain 59]
ATGAAAAAGAAACAAAAATACGCAGGTTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGTTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |