Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | L5I21_RS09410 | Genome accession | NZ_CP091899 |
| Coordinates | 1887931..1888206 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 101-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1842710..1887907 | 1887931..1888206 | flank | 24 |
Gene organization within MGE regions
Location: 1842710..1888206
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L5I21_RS09090 (L5I21_09090) | - | 1842710..1843717 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| L5I21_RS09095 (L5I21_09095) | comGG | 1843846..1844199 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| L5I21_RS09100 (L5I21_09100) | comGF | 1844199..1844633 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| L5I21_RS09105 (L5I21_09105) | - | 1844623..1845024 (-) | 402 | WP_002383134.1 | type II secretion system protein | - |
| L5I21_RS15375 | - | 1845328..1845453 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| L5I21_RS09110 (L5I21_09110) | hemH | 1845750..1846691 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| L5I21_RS09120 (L5I21_09120) | - | 1847431..1847679 (-) | 249 | WP_002383136.1 | hypothetical protein | - |
| L5I21_RS09125 (L5I21_09125) | - | 1847751..1847951 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| L5I21_RS09130 (L5I21_09130) | - | 1848788..1850029 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| L5I21_RS09135 (L5I21_09135) | - | 1850030..1850263 (-) | 234 | WP_002384371.1 | phage holin | - |
| L5I21_RS09140 (L5I21_09140) | - | 1850256..1850477 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| L5I21_RS09145 (L5I21_09145) | - | 1850512..1850667 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| L5I21_RS09150 (L5I21_09150) | - | 1850669..1850989 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| L5I21_RS09155 (L5I21_09155) | - | 1851003..1851494 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| L5I21_RS09160 (L5I21_09160) | - | 1851494..1851781 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| L5I21_RS09165 (L5I21_09165) | - | 1851778..1852374 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| L5I21_RS09170 (L5I21_09170) | - | 1852367..1853248 (-) | 882 | WP_002387290.1 | phage baseplate upper protein | - |
| L5I21_RS09175 (L5I21_09175) | - | 1853267..1856074 (-) | 2808 | WP_002387289.1 | phage tail spike protein | - |
| L5I21_RS09180 (L5I21_09180) | - | 1856056..1856790 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| L5I21_RS09185 (L5I21_09185) | - | 1856780..1859677 (-) | 2898 | WP_002387288.1 | tape measure protein | - |
| L5I21_RS09190 (L5I21_09190) | gpG | 1859925..1860275 (-) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| L5I21_RS09195 (L5I21_09195) | - | 1860328..1861176 (-) | 849 | WP_002387287.1 | major tail protein | - |
| L5I21_RS09200 (L5I21_09200) | - | 1861177..1861551 (-) | 375 | WP_002387286.1 | phage tail terminator family protein | - |
| L5I21_RS09205 (L5I21_09205) | - | 1861554..1861952 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| L5I21_RS09210 (L5I21_09210) | - | 1861945..1862319 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| L5I21_RS09215 (L5I21_09215) | - | 1862316..1862660 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| L5I21_RS09220 (L5I21_09220) | - | 1862674..1862856 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| L5I21_RS09225 (L5I21_09225) | - | 1862885..1863772 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| L5I21_RS09230 (L5I21_09230) | - | 1863786..1864409 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| L5I21_RS09235 (L5I21_09235) | - | 1864578..1864898 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| L5I21_RS09240 (L5I21_09240) | - | 1864955..1865185 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| L5I21_RS09245 (L5I21_09245) | - | 1865186..1867090 (-) | 1905 | WP_010706494.1 | head protein | - |
| L5I21_RS09250 (L5I21_09250) | - | 1867065..1868537 (-) | 1473 | WP_010706495.1 | phage portal protein | - |
| L5I21_RS09255 (L5I21_09255) | terL | 1868549..1869937 (-) | 1389 | WP_002387276.1 | phage terminase large subunit | - |
| L5I21_RS09260 (L5I21_09260) | - | 1869930..1870391 (-) | 462 | WP_002383816.1 | helix-turn-helix domain-containing protein | - |
| L5I21_RS09265 (L5I21_09265) | - | 1870467..1870643 (-) | 177 | WP_010706496.1 | hypothetical protein | - |
| L5I21_RS09270 (L5I21_09270) | - | 1870827..1871348 (-) | 522 | WP_238458205.1 | hypothetical protein | - |
| L5I21_RS09280 (L5I21_09280) | - | 1872730..1873008 (-) | 279 | WP_048947266.1 | hypothetical protein | - |
| L5I21_RS09285 (L5I21_09285) | - | 1873120..1873353 (-) | 234 | Protein_1811 | hypothetical protein | - |
| L5I21_RS09290 (L5I21_09290) | - | 1873937..1874407 (-) | 471 | WP_002383811.1 | hypothetical protein | - |
| L5I21_RS09295 (L5I21_09295) | - | 1874432..1875355 (-) | 924 | WP_002383810.1 | DUF6731 family protein | - |
| L5I21_RS09305 (L5I21_09305) | - | 1876073..1876489 (-) | 417 | WP_010706497.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| L5I21_RS09310 (L5I21_09310) | - | 1877397..1877804 (-) | 408 | WP_025191675.1 | RusA family crossover junction endodeoxyribonuclease | - |
| L5I21_RS09315 (L5I21_09315) | - | 1877801..1878319 (-) | 519 | Protein_1816 | helix-turn-helix domain-containing protein | - |
| L5I21_RS09320 (L5I21_09320) | - | 1878418..1879590 (+) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| L5I21_RS09325 (L5I21_09325) | - | 1879643..1879990 (-) | 348 | Protein_1818 | helix-turn-helix domain-containing protein | - |
| L5I21_RS09330 (L5I21_09330) | - | 1879990..1880190 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| L5I21_RS09335 (L5I21_09335) | - | 1880195..1880578 (-) | 384 | WP_002383802.1 | putative HNHc nuclease | - |
| L5I21_RS09340 (L5I21_09340) | - | 1880617..1880835 (-) | 219 | WP_002383801.1 | hypothetical protein | - |
| L5I21_RS09345 (L5I21_09345) | - | 1880840..1881574 (-) | 735 | WP_002383799.1 | ERF family protein | - |
| L5I21_RS09350 (L5I21_09350) | - | 1881567..1881884 (-) | 318 | WP_002383798.1 | hypothetical protein | - |
| L5I21_RS09355 (L5I21_09355) | - | 1882080..1882418 (-) | 339 | WP_002383796.1 | hypothetical protein | - |
| L5I21_RS09360 (L5I21_09360) | - | 1882455..1882664 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| L5I21_RS09365 (L5I21_09365) | - | 1882719..1882907 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| L5I21_RS09370 (L5I21_09370) | - | 1882933..1883655 (-) | 723 | WP_002387270.1 | Rha family transcriptional regulator | - |
| L5I21_RS09375 (L5I21_09375) | - | 1883678..1883989 (-) | 312 | WP_002403885.1 | hypothetical protein | - |
| L5I21_RS09380 (L5I21_09380) | - | 1884001..1884192 (-) | 192 | WP_002383936.1 | hypothetical protein | - |
| L5I21_RS09385 (L5I21_09385) | - | 1884488..1884829 (+) | 342 | WP_002387267.1 | helix-turn-helix domain-containing protein | - |
| L5I21_RS09390 (L5I21_09390) | - | 1884834..1885484 (+) | 651 | WP_002387266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| L5I21_RS09395 (L5I21_09395) | - | 1885580..1886209 (+) | 630 | WP_002387265.1 | SHOCT domain-containing protein | - |
| L5I21_RS09400 (L5I21_09400) | - | 1886315..1887463 (+) | 1149 | WP_002387264.1 | tyrosine-type recombinase/integrase | - |
| L5I21_RS09405 (L5I21_09405) | comGD | 1887500..1887934 (-) | 435 | Protein_1834 | competence type IV pilus minor pilin ComGD | - |
| L5I21_RS09410 (L5I21_09410) | comGC/cglC | 1887931..1888206 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=654511 L5I21_RS09410 WP_002356991.1 1887931..1888206(-) (comGC/cglC) [Enterococcus faecalis strain 101-1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=654511 L5I21_RS09410 WP_002356991.1 1887931..1888206(-) (comGC/cglC) [Enterococcus faecalis strain 101-1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |