Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | L5I22_RS08860 | Genome accession | NZ_CP091892 |
| Coordinates | 1819638..1819913 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 133-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1770475..1838019 | 1819638..1819913 | within | 0 |
Gene organization within MGE regions
Location: 1770475..1838019
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L5I22_RS08530 (L5I22_08530) | - | 1770475..1772688 (-) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
| L5I22_RS08535 (L5I22_08535) | - | 1772903..1773655 (-) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| L5I22_RS08540 (L5I22_08540) | prmA | 1773657..1774604 (-) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| L5I22_RS08545 (L5I22_08545) | - | 1774620..1775105 (-) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| L5I22_RS08550 (L5I22_08550) | - | 1775062..1775739 (-) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| L5I22_RS08555 (L5I22_08555) | - | 1775868..1777145 (+) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| L5I22_RS08565 (L5I22_08565) | - | 1777473..1777751 (+) | 279 | WP_048948058.1 | hypothetical protein | - |
| L5I22_RS15495 | - | 1777758..1777829 (+) | 72 | Protein_1671 | Rrf2 family transcriptional regulator | - |
| L5I22_RS08570 (L5I22_08570) | - | 1778067..1778540 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| L5I22_RS08575 (L5I22_08575) | - | 1778652..1779839 (-) | 1188 | WP_002357064.1 | acetate kinase | - |
| L5I22_RS08580 (L5I22_08580) | - | 1779864..1780871 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| L5I22_RS08585 (L5I22_08585) | comGG | 1781000..1781353 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| L5I22_RS08590 (L5I22_08590) | comGF | 1781353..1781787 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| L5I22_RS08595 (L5I22_08595) | - | 1781777..1782148 (-) | 372 | WP_170310356.1 | type II secretion system protein | - |
| L5I22_RS08600 (L5I22_08600) | hemH | 1782903..1783844 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| L5I22_RS08610 (L5I22_08610) | - | 1784560..1784832 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| L5I22_RS08615 (L5I22_08615) | - | 1784904..1785104 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| L5I22_RS08620 (L5I22_08620) | - | 1785957..1787216 (-) | 1260 | WP_002381740.1 | LysM peptidoglycan-binding domain-containing protein | - |
| L5I22_RS08625 (L5I22_08625) | - | 1787229..1787609 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| L5I22_RS08630 (L5I22_08630) | - | 1787620..1787742 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| L5I22_RS08635 (L5I22_08635) | - | 1787744..1788139 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| L5I22_RS08640 (L5I22_08640) | - | 1788158..1788610 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| L5I22_RS08645 (L5I22_08645) | - | 1788627..1789367 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| L5I22_RS08650 (L5I22_08650) | - | 1789373..1790818 (-) | 1446 | WP_049098484.1 | phage tail spike protein | - |
| L5I22_RS08655 (L5I22_08655) | - | 1790818..1791540 (-) | 723 | WP_002363380.1 | hypothetical protein | - |
| L5I22_RS08660 (L5I22_08660) | - | 1791537..1795991 (-) | 4455 | WP_049098486.1 | phage tail tape measure protein | - |
| L5I22_RS08665 (L5I22_08665) | - | 1795978..1796283 (-) | 306 | WP_002364305.1 | hypothetical protein | - |
| L5I22_RS08670 (L5I22_08670) | - | 1796352..1796750 (-) | 399 | WP_002363376.1 | tail assembly chaperone | - |
| L5I22_RS08675 (L5I22_08675) | - | 1796813..1797121 (-) | 309 | WP_002381737.1 | hypothetical protein | - |
| L5I22_RS08680 (L5I22_08680) | - | 1797124..1797729 (-) | 606 | WP_002381736.1 | phage major tail protein, TP901-1 family | - |
| L5I22_RS08685 (L5I22_08685) | - | 1797749..1798141 (-) | 393 | WP_002381735.1 | hypothetical protein | - |
| L5I22_RS08690 (L5I22_08690) | - | 1798138..1798476 (-) | 339 | WP_002381734.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| L5I22_RS08695 (L5I22_08695) | - | 1798473..1798748 (-) | 276 | WP_002364301.1 | hypothetical protein | - |
| L5I22_RS08700 (L5I22_08700) | - | 1798745..1799077 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| L5I22_RS08705 (L5I22_08705) | - | 1799148..1800044 (-) | 897 | WP_002363368.1 | hypothetical protein | - |
| L5I22_RS08710 (L5I22_08710) | - | 1800057..1800692 (-) | 636 | WP_010717040.1 | DUF4355 domain-containing protein | - |
| L5I22_RS08715 (L5I22_08715) | - | 1800815..1801741 (-) | 927 | WP_002363365.1 | minor capsid protein | - |
| L5I22_RS08720 (L5I22_08720) | - | 1801734..1803218 (-) | 1485 | WP_048948059.1 | phage portal protein | - |
| L5I22_RS08725 (L5I22_08725) | - | 1803218..1804501 (-) | 1284 | WP_002381730.1 | PBSX family phage terminase large subunit | - |
| L5I22_RS08730 (L5I22_08730) | - | 1804482..1804916 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| L5I22_RS08735 (L5I22_08735) | - | 1804948..1805178 (-) | 231 | WP_002400650.1 | hypothetical protein | - |
| L5I22_RS08740 (L5I22_08740) | - | 1805550..1806143 (-) | 594 | WP_010717041.1 | hypothetical protein | - |
| L5I22_RS08745 (L5I22_08745) | - | 1806165..1807139 (-) | 975 | WP_010717042.1 | DUF6731 family protein | - |
| L5I22_RS08755 (L5I22_08755) | - | 1807856..1808272 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| L5I22_RS08760 (L5I22_08760) | - | 1809180..1809614 (-) | 435 | WP_025192316.1 | RusA family crossover junction endodeoxyribonuclease | - |
| L5I22_RS08765 (L5I22_08765) | - | 1809623..1809922 (-) | 300 | WP_002357015.1 | MazG-like family protein | - |
| L5I22_RS08770 (L5I22_08770) | - | 1809923..1810225 (-) | 303 | WP_002357013.1 | hypothetical protein | - |
| L5I22_RS08775 (L5I22_08775) | - | 1810229..1811086 (-) | 858 | WP_002357012.1 | helix-turn-helix domain-containing protein | - |
| L5I22_RS08780 (L5I22_08780) | - | 1811086..1811286 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| L5I22_RS08785 (L5I22_08785) | - | 1811291..1811932 (-) | 642 | WP_010717044.1 | putative HNHc nuclease | - |
| L5I22_RS08790 (L5I22_08790) | - | 1811937..1812671 (-) | 735 | WP_002381724.1 | ERF family protein | - |
| L5I22_RS08795 (L5I22_08795) | - | 1812664..1812981 (-) | 318 | WP_002401330.1 | hypothetical protein | - |
| L5I22_RS08800 (L5I22_08800) | - | 1813201..1813755 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| L5I22_RS08805 (L5I22_08805) | - | 1814182..1814376 (-) | 195 | WP_002381722.1 | hypothetical protein | - |
| L5I22_RS08810 (L5I22_08810) | - | 1814413..1814622 (-) | 210 | WP_002381721.1 | hypothetical protein | - |
| L5I22_RS08815 (L5I22_08815) | - | 1814677..1814865 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| L5I22_RS08820 (L5I22_08820) | - | 1814891..1815616 (-) | 726 | WP_002381720.1 | phage regulatory protein | - |
| L5I22_RS08825 (L5I22_08825) | - | 1815655..1815966 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| L5I22_RS08830 (L5I22_08830) | - | 1815977..1816153 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| L5I22_RS08835 (L5I22_08835) | - | 1816465..1816797 (+) | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | - |
| L5I22_RS08840 (L5I22_08840) | - | 1816814..1817158 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| L5I22_RS08845 (L5I22_08845) | - | 1817194..1817922 (+) | 729 | WP_002381717.1 | potassium channel family protein | - |
| L5I22_RS08850 (L5I22_08850) | - | 1818022..1819170 (+) | 1149 | WP_002381716.1 | site-specific integrase | - |
| L5I22_RS08855 (L5I22_08855) | comGD | 1819198..1819641 (-) | 444 | WP_002381715.1 | competence type IV pilus minor pilin ComGD | - |
| L5I22_RS08860 (L5I22_08860) | comGC/cglC | 1819638..1819913 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| L5I22_RS08865 (L5I22_08865) | comGB | 1819913..1820959 (-) | 1047 | WP_047649127.1 | competence type IV pilus assembly protein ComGB | - |
| L5I22_RS08870 (L5I22_08870) | comGA | 1820916..1821884 (-) | 969 | WP_002401324.1 | competence type IV pilus ATPase ComGA | - |
| L5I22_RS08875 (L5I22_08875) | - | 1822125..1823453 (-) | 1329 | WP_002362058.1 | amino acid permease | - |
| L5I22_RS08880 (L5I22_08880) | rlmN | 1823743..1824816 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| L5I22_RS08885 (L5I22_08885) | - | 1824942..1826771 (-) | 1830 | WP_002392355.1 | ABC transporter permease | - |
| L5I22_RS08890 (L5I22_08890) | - | 1826761..1827510 (-) | 750 | WP_047649125.1 | ABC transporter ATP-binding protein | - |
| L5I22_RS08895 (L5I22_08895) | - | 1827628..1828329 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| L5I22_RS08900 (L5I22_08900) | - | 1828459..1830882 (-) | 2424 | WP_002364367.1 | DNA translocase FtsK | - |
| L5I22_RS08905 (L5I22_08905) | - | 1831196..1832407 (-) | 1212 | WP_002378475.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| L5I22_RS08910 (L5I22_08910) | - | 1832436..1833341 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| L5I22_RS08915 (L5I22_08915) | - | 1833463..1834443 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| L5I22_RS08920 (L5I22_08920) | cydC | 1834523..1836289 (-) | 1767 | WP_002379581.1 | thiol reductant ABC exporter subunit CydC | - |
| L5I22_RS08925 (L5I22_08925) | cydD | 1836286..1838019 (-) | 1734 | WP_002364369.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=654398 L5I22_RS08860 WP_002356991.1 1819638..1819913(-) (comGC/cglC) [Enterococcus faecalis strain 133-1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=654398 L5I22_RS08860 WP_002356991.1 1819638..1819913(-) (comGC/cglC) [Enterococcus faecalis strain 133-1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |