Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | L3I92_RS04970 | Genome accession | NZ_CP091412 |
| Coordinates | 941867..942178 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472255.1 | Uniprot ID | A0A0U1MLR1 |
| Organism | Staphylococcus aureus strain ATR-20003 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 936867..947178
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3I92_RS04940 (L3I92_000988) | - | 937650..937853 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| L3I92_RS04945 (L3I92_000989) | - | 937850..938836 (+) | 987 | WP_111187437.1 | ROK family glucokinase | - |
| L3I92_RS04950 (L3I92_000990) | - | 938836..939165 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| L3I92_RS04955 (L3I92_000991) | - | 939162..939785 (+) | 624 | WP_001223009.1 | MBL fold metallo-hydrolase | - |
| L3I92_RS04960 (L3I92_000992) | comGA | 939837..940811 (+) | 975 | WP_000697223.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| L3I92_RS04965 (L3I92_000993) | comGB | 940783..941853 (+) | 1071 | WP_000776409.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| L3I92_RS04970 (L3I92_000994) | comGC | 941867..942178 (+) | 312 | WP_000472255.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| L3I92_RS04975 (L3I92_000995) | comGD | 942156..942602 (+) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| L3I92_RS04980 (L3I92_000996) | comGE | 942589..942888 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| L3I92_RS04985 (L3I92_000997) | comGF | 942806..943303 (+) | 498 | WP_001796472.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| L3I92_RS04990 (L3I92_000998) | - | 943400..943546 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| L3I92_RS04995 (L3I92_000999) | - | 943536..944060 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| L3I92_RS05000 (L3I92_001000) | gcvT | 944219..945310 (+) | 1092 | WP_237269230.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| L3I92_RS05005 (L3I92_001001) | gcvPA | 945330..946676 (+) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11301.33 Da Isoelectric Point: 8.5268
>NTDB_id=650879 L3I92_RS04970 WP_000472255.1 941867..942178(+) (comGC) [Staphylococcus aureus strain ATR-20003]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGESITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGESITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=650879 L3I92_RS04970 WP_000472255.1 941867..942178(+) (comGC) [Staphylococcus aureus strain ATR-20003]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGTCAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGTCAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
99.029 |
100 |
0.99 |
| comGC | Staphylococcus aureus MW2 |
99.029 |
100 |
0.99 |
| comGC/cglC | Streptococcus mitis SK321 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |