Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | LQ054_RS09265 | Genome accession | NZ_CP091235 |
| Coordinates | 1877990..1878265 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 705 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1834483..1896372 | 1877990..1878265 | within | 0 |
Gene organization within MGE regions
Location: 1834483..1896372
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ054_RS08955 (LQ054_08955) | - | 1834483..1835490 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| LQ054_RS08960 (LQ054_08960) | comGG | 1835619..1835972 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| LQ054_RS08965 (LQ054_08965) | comGF | 1835972..1836406 (-) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| LQ054_RS08970 (LQ054_08970) | - | 1836396..1836767 (-) | 372 | WP_171025395.1 | type II secretion system protein | - |
| LQ054_RS14170 | - | 1837101..1837226 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| LQ054_RS08975 (LQ054_08975) | hemH | 1837524..1838465 (-) | 942 | WP_116491831.1 | ferrochelatase | - |
| LQ054_RS08985 (LQ054_08985) | - | 1838787..1839596 (-) | 810 | WP_159162083.1 | DUF3800 domain-containing protein | - |
| LQ054_RS08990 (LQ054_08990) | - | 1840233..1841534 (-) | 1302 | WP_114232968.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LQ054_RS08995 (LQ054_08995) | - | 1841537..1841743 (-) | 207 | WP_114232969.1 | phage holin | - |
| LQ054_RS09000 (LQ054_09000) | - | 1841740..1841961 (-) | 222 | WP_002397443.1 | hypothetical protein | - |
| LQ054_RS09005 (LQ054_09005) | - | 1841989..1842144 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| LQ054_RS09010 (LQ054_09010) | - | 1842146..1842466 (-) | 321 | WP_002388445.1 | hypothetical protein | - |
| LQ054_RS09015 (LQ054_09015) | - | 1842480..1842971 (-) | 492 | WP_010711694.1 | hypothetical protein | - |
| LQ054_RS09020 (LQ054_09020) | - | 1842971..1843249 (-) | 279 | WP_116491832.1 | hypothetical protein | - |
| LQ054_RS09025 (LQ054_09025) | - | 1843246..1843842 (-) | 597 | WP_116491833.1 | hypothetical protein | - |
| LQ054_RS09030 (LQ054_09030) | - | 1843835..1844716 (-) | 882 | WP_116491834.1 | phage baseplate upper protein | - |
| LQ054_RS09035 (LQ054_09035) | - | 1844735..1847542 (-) | 2808 | WP_164549299.1 | phage tail spike protein | - |
| LQ054_RS09040 (LQ054_09040) | - | 1847524..1848258 (-) | 735 | WP_104670712.1 | phage tail protein | - |
| LQ054_RS09045 (LQ054_09045) | - | 1848248..1851145 (-) | 2898 | WP_164549302.1 | tape measure protein | - |
| LQ054_RS09050 (LQ054_09050) | - | 1851393..1851743 (-) | 351 | WP_010820912.1 | hypothetical protein | - |
| LQ054_RS09055 (LQ054_09055) | - | 1851795..1852643 (-) | 849 | WP_002387287.1 | major tail protein | - |
| LQ054_RS09060 (LQ054_09060) | - | 1852644..1853018 (-) | 375 | WP_116491837.1 | DUF6838 family protein | - |
| LQ054_RS09065 (LQ054_09065) | - | 1853021..1853419 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| LQ054_RS09070 (LQ054_09070) | - | 1853412..1853786 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| LQ054_RS09075 (LQ054_09075) | - | 1853783..1854127 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| LQ054_RS09080 (LQ054_09080) | - | 1854141..1854323 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| LQ054_RS09085 (LQ054_09085) | - | 1854352..1855239 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| LQ054_RS09090 (LQ054_09090) | - | 1855253..1855876 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| LQ054_RS09095 (LQ054_09095) | - | 1856095..1856415 (-) | 321 | WP_116491838.1 | hypothetical protein | - |
| LQ054_RS09100 (LQ054_09100) | - | 1856472..1856702 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| LQ054_RS09105 (LQ054_09105) | - | 1856703..1858604 (-) | 1902 | WP_116491839.1 | head protein | - |
| LQ054_RS09110 (LQ054_09110) | - | 1858582..1860054 (-) | 1473 | WP_116491840.1 | phage portal protein | - |
| LQ054_RS09115 (LQ054_09115) | terL | 1860066..1861454 (-) | 1389 | WP_164549303.1 | phage terminase large subunit | - |
| LQ054_RS09120 (LQ054_09120) | - | 1861447..1861908 (-) | 462 | WP_002399680.1 | helix-turn-helix domain-containing protein | - |
| LQ054_RS09125 (LQ054_09125) | - | 1861939..1862169 (-) | 231 | WP_114232998.1 | hypothetical protein | - |
| LQ054_RS09135 (LQ054_09135) | - | 1863010..1863426 (-) | 417 | WP_116491841.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LQ054_RS09140 (LQ054_09140) | - | 1863800..1864006 (-) | 207 | WP_116491842.1 | hypothetical protein | - |
| LQ054_RS09145 (LQ054_09145) | - | 1864020..1864604 (-) | 585 | WP_010711679.1 | DUF3850 domain-containing protein | - |
| LQ054_RS09150 (LQ054_09150) | - | 1864616..1864864 (-) | 249 | WP_002415426.1 | hypothetical protein | - |
| LQ054_RS09155 (LQ054_09155) | - | 1864861..1865214 (-) | 354 | WP_002415427.1 | hypothetical protein | - |
| LQ054_RS09160 (LQ054_09160) | - | 1865364..1866098 (-) | 735 | WP_249455863.1 | N-6 DNA methylase | - |
| LQ054_RS09165 (LQ054_09165) | - | 1866409..1866837 (-) | 429 | WP_164549300.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LQ054_RS09170 (LQ054_09170) | - | 1866834..1867787 (-) | 954 | WP_116491844.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LQ054_RS09175 (LQ054_09175) | - | 1867791..1868471 (-) | 681 | WP_116491845.1 | putative HNHc nuclease | - |
| LQ054_RS09180 (LQ054_09180) | - | 1868468..1869406 (-) | 939 | WP_116491846.1 | DUF1351 domain-containing protein | - |
| LQ054_RS09185 (LQ054_09185) | - | 1869391..1870068 (-) | 678 | WP_116491847.1 | ERF family protein | - |
| LQ054_RS09190 (LQ054_09190) | - | 1870061..1870306 (-) | 246 | WP_116491848.1 | hypothetical protein | - |
| LQ054_RS09195 (LQ054_09195) | - | 1870486..1870809 (-) | 324 | WP_002368201.1 | hypothetical protein | - |
| LQ054_RS09200 (LQ054_09200) | - | 1870882..1871625 (-) | 744 | WP_002368200.1 | hypothetical protein | - |
| LQ054_RS09205 (LQ054_09205) | - | 1871638..1872045 (-) | 408 | WP_002363338.1 | hypothetical protein | - |
| LQ054_RS09210 (LQ054_09210) | - | 1872114..1872314 (-) | 201 | WP_116491849.1 | hypothetical protein | - |
| LQ054_RS09215 (LQ054_09215) | - | 1872325..1872510 (-) | 186 | WP_099704312.1 | hypothetical protein | - |
| LQ054_RS09220 (LQ054_09220) | - | 1872521..1873234 (-) | 714 | WP_116491850.1 | Rha family transcriptional regulator | - |
| LQ054_RS09225 (LQ054_09225) | - | 1873273..1873590 (-) | 318 | WP_002356999.1 | hypothetical protein | - |
| LQ054_RS09230 (LQ054_09230) | - | 1873596..1873787 (-) | 192 | WP_249455864.1 | hypothetical protein | - |
| LQ054_RS09235 (LQ054_09235) | - | 1874080..1874421 (+) | 342 | WP_002396615.1 | helix-turn-helix transcriptional regulator | - |
| LQ054_RS09240 (LQ054_09240) | - | 1874426..1875073 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LQ054_RS09245 (LQ054_09245) | - | 1875191..1875955 (+) | 765 | WP_229077509.1 | LysM domain-containing protein | - |
| LQ054_RS09250 (LQ054_09250) | - | 1875970..1876299 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| LQ054_RS09255 (LQ054_09255) | - | 1876374..1877522 (+) | 1149 | WP_116491852.1 | site-specific integrase | - |
| LQ054_RS09260 (LQ054_09260) | comGD | 1877550..1877993 (-) | 444 | WP_116491816.1 | competence type IV pilus minor pilin ComGD | - |
| LQ054_RS09265 (LQ054_09265) | comGC/cglC | 1877990..1878265 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LQ054_RS09270 (LQ054_09270) | comGB | 1878265..1879311 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| LQ054_RS09275 (LQ054_09275) | comGA | 1879268..1880236 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| LQ054_RS09280 (LQ054_09280) | - | 1880477..1881805 (-) | 1329 | WP_002360022.1 | amino acid permease | - |
| LQ054_RS09285 (LQ054_09285) | rlmN | 1882095..1883168 (-) | 1074 | WP_002378471.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| LQ054_RS09290 (LQ054_09290) | - | 1883294..1885123 (-) | 1830 | WP_002401809.1 | ABC transporter permease | - |
| LQ054_RS09295 (LQ054_09295) | - | 1885113..1885862 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| LQ054_RS09300 (LQ054_09300) | - | 1885980..1886681 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| LQ054_RS09305 (LQ054_09305) | - | 1886812..1889235 (-) | 2424 | WP_002378474.1 | DNA translocase FtsK | - |
| LQ054_RS09310 (LQ054_09310) | - | 1889549..1890760 (-) | 1212 | WP_002378475.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| LQ054_RS09315 (LQ054_09315) | - | 1890789..1891694 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| LQ054_RS09320 (LQ054_09320) | - | 1891816..1892796 (+) | 981 | WP_002378476.1 | polyprenyl synthetase family protein | - |
| LQ054_RS09325 (LQ054_09325) | cydC | 1892876..1894642 (-) | 1767 | WP_002364246.1 | thiol reductant ABC exporter subunit CydC | - |
| LQ054_RS09330 (LQ054_09330) | cydD | 1894639..1896372 (-) | 1734 | WP_002378477.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=648697 LQ054_RS09265 WP_002356991.1 1877990..1878265(-) (comGC/cglC) [Enterococcus faecalis strain 705]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=648697 LQ054_RS09265 WP_002356991.1 1877990..1878265(-) (comGC/cglC) [Enterococcus faecalis strain 705]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |