Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | LQ055_RS09580 | Genome accession | NZ_CP091231 |
| Coordinates | 1901301..1901576 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 732 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1858257..1922114 | 1901301..1901576 | within | 0 |
Gene organization within MGE regions
Location: 1858257..1922114
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ055_RS09280 (LQ055_09280) | - | 1858257..1859264 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| LQ055_RS09285 (LQ055_09285) | comGG | 1859393..1859746 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| LQ055_RS09290 (LQ055_09290) | comGF | 1859746..1860180 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| LQ055_RS09295 (LQ055_09295) | - | 1860170..1860496 (-) | 327 | WP_010775953.1 | type II secretion system protein | - |
| LQ055_RS09300 (LQ055_09300) | hemH | 1861298..1862239 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| LQ055_RS09310 (LQ055_09310) | - | 1862955..1863227 (-) | 273 | WP_002370964.1 | hypothetical protein | - |
| LQ055_RS09315 (LQ055_09315) | - | 1863299..1863499 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| LQ055_RS09320 (LQ055_09320) | - | 1864336..1865577 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LQ055_RS09325 (LQ055_09325) | - | 1865578..1865811 (-) | 234 | WP_002384371.1 | phage holin | - |
| LQ055_RS09330 (LQ055_09330) | - | 1865804..1866025 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| LQ055_RS09335 (LQ055_09335) | - | 1866060..1866215 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| LQ055_RS09340 (LQ055_09340) | - | 1866217..1866537 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| LQ055_RS09345 (LQ055_09345) | - | 1866551..1867042 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| LQ055_RS09350 (LQ055_09350) | - | 1867042..1867329 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| LQ055_RS09355 (LQ055_09355) | - | 1867326..1867922 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| LQ055_RS09360 (LQ055_09360) | - | 1867915..1868796 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| LQ055_RS09365 (LQ055_09365) | - | 1868815..1871622 (-) | 2808 | WP_249488575.1 | phage tail spike protein | - |
| LQ055_RS09370 (LQ055_09370) | - | 1871604..1872338 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| LQ055_RS09375 (LQ055_09375) | - | 1872328..1875225 (-) | 2898 | WP_002393612.1 | tape measure protein | - |
| LQ055_RS09380 (LQ055_09380) | - | 1875473..1875823 (-) | 351 | WP_002370959.1 | hypothetical protein | - |
| LQ055_RS09385 (LQ055_09385) | - | 1875876..1876724 (-) | 849 | WP_002384363.1 | major tail protein | - |
| LQ055_RS09390 (LQ055_09390) | - | 1876725..1877099 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| LQ055_RS09395 (LQ055_09395) | - | 1877102..1877500 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| LQ055_RS09400 (LQ055_09400) | - | 1877493..1877861 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| LQ055_RS09405 (LQ055_09405) | - | 1877858..1878202 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| LQ055_RS09410 (LQ055_09410) | - | 1878216..1878398 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| LQ055_RS09415 (LQ055_09415) | - | 1878427..1879314 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| LQ055_RS09420 (LQ055_09420) | - | 1879328..1879951 (-) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| LQ055_RS09425 (LQ055_09425) | - | 1880175..1880489 (-) | 315 | WP_174082485.1 | hypothetical protein | - |
| LQ055_RS09430 (LQ055_09430) | - | 1880554..1880775 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| LQ055_RS09435 (LQ055_09435) | - | 1880772..1882529 (-) | 1758 | WP_002384360.1 | head protein | - |
| LQ055_RS09440 (LQ055_09440) | - | 1882504..1883991 (-) | 1488 | WP_002384358.1 | phage portal protein | - |
| LQ055_RS09445 (LQ055_09445) | - | 1884003..1885292 (-) | 1290 | WP_002403123.1 | PBSX family phage terminase large subunit | - |
| LQ055_RS09450 (LQ055_09450) | terS | 1885264..1886067 (-) | 804 | WP_002389117.1 | phage terminase small subunit | - |
| LQ055_RS09455 (LQ055_09455) | - | 1886336..1887253 (+) | 918 | WP_002370955.1 | hypothetical protein | - |
| LQ055_RS09460 (LQ055_09460) | - | 1887291..1887869 (-) | 579 | WP_002370953.1 | sce7726 family protein | - |
| LQ055_RS09465 (LQ055_09465) | - | 1888013..1888246 (-) | 234 | WP_002389079.1 | hypothetical protein | - |
| LQ055_RS09475 (LQ055_09475) | - | 1889240..1889656 (-) | 417 | WP_010816133.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LQ055_RS09480 (LQ055_09480) | - | 1890563..1890988 (-) | 426 | WP_002389212.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LQ055_RS09485 (LQ055_09485) | - | 1891006..1891305 (-) | 300 | WP_002389080.1 | MazG-like family protein | - |
| LQ055_RS09490 (LQ055_09490) | - | 1891306..1891608 (-) | 303 | WP_002389299.1 | hypothetical protein | - |
| LQ055_RS09495 (LQ055_09495) | - | 1891612..1892613 (-) | 1002 | WP_002389256.1 | Lin1244/Lin1753 domain-containing protein | - |
| LQ055_RS09500 (LQ055_09500) | - | 1892650..1893543 (-) | 894 | WP_002369907.1 | recombinase RecT | - |
| LQ055_RS09505 (LQ055_09505) | - | 1893543..1894487 (-) | 945 | WP_002389314.1 | lambda-exonuclease family protein | - |
| LQ055_RS09510 (LQ055_09510) | - | 1894585..1894812 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| LQ055_RS09515 (LQ055_09515) | - | 1894812..1895135 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| LQ055_RS09520 (LQ055_09520) | - | 1895179..1895364 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| LQ055_RS09525 (LQ055_09525) | - | 1895355..1895549 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| LQ055_RS09530 (LQ055_09530) | - | 1895602..1895784 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| LQ055_RS09535 (LQ055_09535) | - | 1895824..1896545 (-) | 722 | Protein_1858 | ORF6C domain-containing protein | - |
| LQ055_RS09540 (LQ055_09540) | - | 1896584..1896901 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| LQ055_RS09545 (LQ055_09545) | - | 1896907..1897098 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| LQ055_RS09550 (LQ055_09550) | - | 1897389..1897733 (+) | 345 | WP_002385819.1 | helix-turn-helix transcriptional regulator | - |
| LQ055_RS09555 (LQ055_09555) | - | 1897746..1898384 (+) | 639 | WP_002389292.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LQ055_RS09560 (LQ055_09560) | - | 1898502..1899266 (+) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| LQ055_RS09565 (LQ055_09565) | - | 1899281..1899610 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| LQ055_RS09570 (LQ055_09570) | - | 1899685..1900833 (+) | 1149 | WP_002389015.1 | site-specific integrase | - |
| LQ055_RS09575 (LQ055_09575) | comGD | 1900861..1901304 (-) | 444 | WP_025189135.1 | competence type IV pilus minor pilin ComGD | - |
| LQ055_RS09580 (LQ055_09580) | comGC/cglC | 1901301..1901576 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LQ055_RS09585 (LQ055_09585) | comGB | 1901576..1902622 (-) | 1047 | WP_002401325.1 | competence type IV pilus assembly protein ComGB | - |
| LQ055_RS09590 (LQ055_09590) | comGA | 1902579..1903547 (-) | 969 | WP_002401324.1 | competence type IV pilus ATPase ComGA | - |
| LQ055_RS09595 (LQ055_09595) | - | 1903787..1905115 (-) | 1329 | WP_002362058.1 | amino acid permease | - |
| LQ055_RS09600 (LQ055_09600) | rlmN | 1905405..1906478 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| LQ055_RS09605 (LQ055_09605) | - | 1906603..1908432 (-) | 1830 | WP_002391458.1 | ABC transporter permease | - |
| LQ055_RS09610 (LQ055_09610) | - | 1908422..1909171 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| LQ055_RS09615 (LQ055_09615) | - | 1909289..1909990 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| LQ055_RS09620 (LQ055_09620) | - | 1910121..1912544 (-) | 2424 | WP_002411391.1 | DNA translocase FtsK | - |
| LQ055_RS09625 (LQ055_09625) | - | 1912858..1914069 (-) | 1212 | WP_002411392.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| LQ055_RS09630 (LQ055_09630) | - | 1914098..1915003 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| LQ055_RS09635 (LQ055_09635) | - | 1915125..1916105 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| LQ055_RS09640 (LQ055_09640) | cydC | 1916185..1917951 (-) | 1767 | WP_002411395.1 | thiol reductant ABC exporter subunit CydC | - |
| LQ055_RS09645 (LQ055_09645) | cydD | 1917948..1919681 (-) | 1734 | WP_002364369.1 | thiol reductant ABC exporter subunit CydD | - |
| LQ055_RS09650 (LQ055_09650) | cydB | 1919686..1920699 (-) | 1014 | WP_002356976.1 | cytochrome d ubiquinol oxidase subunit II | - |
| LQ055_RS09655 (LQ055_09655) | - | 1920696..1922114 (-) | 1419 | WP_002356974.1 | cytochrome ubiquinol oxidase subunit I | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=648659 LQ055_RS09580 WP_002356991.1 1901301..1901576(-) (comGC/cglC) [Enterococcus faecalis strain 732]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=648659 LQ055_RS09580 WP_002356991.1 1901301..1901576(-) (comGC/cglC) [Enterococcus faecalis strain 732]
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |