Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | LQ066_RS08400 | Genome accession | NZ_CP091227 |
| Coordinates | 1718080..1718355 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 661 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1675693..1718056 | 1718080..1718355 | flank | 24 |
Gene organization within MGE regions
Location: 1675693..1718355
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ066_RS08105 (LQ066_08105) | - | 1675693..1676700 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| LQ066_RS08110 (LQ066_08110) | comGG | 1676829..1677182 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| LQ066_RS08115 (LQ066_08115) | comGF | 1677182..1677616 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| LQ066_RS08120 (LQ066_08120) | - | 1677606..1677977 (-) | 372 | WP_171025395.1 | type II secretion system protein | - |
| LQ066_RS14090 | - | 1678311..1678436 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| LQ066_RS08125 (LQ066_08125) | hemH | 1678733..1679674 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| LQ066_RS08135 (LQ066_08135) | - | 1680414..1680662 (-) | 249 | WP_002383136.1 | hypothetical protein | - |
| LQ066_RS08140 (LQ066_08140) | - | 1680734..1680934 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| LQ066_RS08145 (LQ066_08145) | - | 1681771..1683012 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LQ066_RS08150 (LQ066_08150) | - | 1683013..1683246 (-) | 234 | WP_002384371.1 | phage holin | - |
| LQ066_RS08155 (LQ066_08155) | - | 1683239..1683460 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| LQ066_RS08160 (LQ066_08160) | - | 1683495..1683650 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| LQ066_RS08165 (LQ066_08165) | - | 1683652..1683972 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| LQ066_RS08170 (LQ066_08170) | - | 1683986..1684477 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| LQ066_RS08175 (LQ066_08175) | - | 1684477..1684764 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| LQ066_RS08180 (LQ066_08180) | - | 1684761..1685357 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| LQ066_RS08185 (LQ066_08185) | - | 1685350..1686231 (-) | 882 | WP_104659692.1 | phage baseplate upper protein | - |
| LQ066_RS08190 (LQ066_08190) | - | 1686250..1689057 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| LQ066_RS08195 (LQ066_08195) | - | 1689039..1689773 (-) | 735 | WP_002403868.1 | tail protein | - |
| LQ066_RS08200 (LQ066_08200) | - | 1689763..1692660 (-) | 2898 | WP_162782897.1 | tape measure protein | - |
| LQ066_RS08205 (LQ066_08205) | - | 1692908..1693258 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| LQ066_RS08210 (LQ066_08210) | - | 1693311..1694159 (-) | 849 | WP_104659694.1 | major tail protein | - |
| LQ066_RS08215 (LQ066_08215) | - | 1694160..1694534 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| LQ066_RS08220 (LQ066_08220) | - | 1694537..1694935 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| LQ066_RS08225 (LQ066_08225) | - | 1694928..1695296 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| LQ066_RS08230 (LQ066_08230) | - | 1695293..1695637 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| LQ066_RS08235 (LQ066_08235) | - | 1695651..1695833 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| LQ066_RS08240 (LQ066_08240) | - | 1695862..1696749 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| LQ066_RS08245 (LQ066_08245) | - | 1696763..1697386 (-) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| LQ066_RS08250 (LQ066_08250) | - | 1697604..1697924 (-) | 321 | WP_002389265.1 | hypothetical protein | - |
| LQ066_RS08255 (LQ066_08255) | - | 1697989..1698210 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| LQ066_RS08260 (LQ066_08260) | - | 1698207..1699964 (-) | 1758 | WP_104659695.1 | head protein | - |
| LQ066_RS08265 (LQ066_08265) | - | 1699939..1701426 (-) | 1488 | WP_002384358.1 | phage portal protein | - |
| LQ066_RS08270 (LQ066_08270) | - | 1701438..1702727 (-) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| LQ066_RS08275 (LQ066_08275) | terS | 1702699..1703502 (-) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| LQ066_RS08280 (LQ066_08280) | - | 1703549..1704271 (-) | 723 | WP_104659696.1 | DUF5677 domain-containing protein | - |
| LQ066_RS08285 (LQ066_08285) | - | 1704660..1705220 (-) | 561 | WP_104659697.1 | hypothetical protein | - |
| LQ066_RS08290 (LQ066_08290) | - | 1705250..1706203 (-) | 954 | WP_104659698.1 | DUF6731 family protein | - |
| LQ066_RS08300 (LQ066_08300) | - | 1706913..1707329 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LQ066_RS08305 (LQ066_08305) | - | 1708236..1708670 (-) | 435 | WP_002402491.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LQ066_RS08310 (LQ066_08310) | - | 1708679..1708978 (-) | 300 | WP_002372047.1 | MazG-like family protein | - |
| LQ066_RS08315 (LQ066_08315) | - | 1708979..1709281 (-) | 303 | WP_002368214.1 | hypothetical protein | - |
| LQ066_RS08320 (LQ066_08320) | - | 1709278..1710138 (-) | 861 | WP_002402489.1 | helix-turn-helix domain-containing protein | - |
| LQ066_RS08325 (LQ066_08325) | - | 1710138..1710338 (-) | 201 | WP_010715320.1 | hypothetical protein | - |
| LQ066_RS08330 (LQ066_08330) | - | 1710343..1710984 (-) | 642 | WP_002402487.1 | putative HNHc nuclease | - |
| LQ066_RS08335 (LQ066_08335) | - | 1710989..1711723 (-) | 735 | WP_002402486.1 | ERF family protein | - |
| LQ066_RS08340 (LQ066_08340) | - | 1711716..1712033 (-) | 318 | WP_002402485.1 | hypothetical protein | - |
| LQ066_RS08345 (LQ066_08345) | - | 1712229..1712567 (-) | 339 | WP_002402484.1 | hypothetical protein | - |
| LQ066_RS08350 (LQ066_08350) | - | 1712604..1712813 (-) | 210 | WP_249476728.1 | hypothetical protein | - |
| LQ066_RS08355 (LQ066_08355) | - | 1712868..1713056 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| LQ066_RS08360 (LQ066_08360) | - | 1713082..1713804 (-) | 723 | WP_002387270.1 | phage regulatory protein | - |
| LQ066_RS08365 (LQ066_08365) | - | 1713827..1714138 (-) | 312 | WP_104659699.1 | hypothetical protein | - |
| LQ066_RS08370 (LQ066_08370) | - | 1714150..1714341 (-) | 192 | WP_002383936.1 | hypothetical protein | - |
| LQ066_RS08375 (LQ066_08375) | - | 1714637..1714978 (+) | 342 | WP_002387267.1 | helix-turn-helix transcriptional regulator | - |
| LQ066_RS08380 (LQ066_08380) | - | 1714983..1715633 (+) | 651 | WP_002387266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LQ066_RS08385 (LQ066_08385) | - | 1715729..1716358 (+) | 630 | WP_002410530.1 | SHOCT domain-containing protein | - |
| LQ066_RS08390 (LQ066_08390) | - | 1716464..1717612 (+) | 1149 | WP_002387264.1 | site-specific integrase | - |
| LQ066_RS08395 (LQ066_08395) | comGD | 1717649..1718083 (-) | 435 | Protein_1637 | competence type IV pilus minor pilin ComGD | - |
| LQ066_RS08400 (LQ066_08400) | comGC/cglC | 1718080..1718355 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=648621 LQ066_RS08400 WP_002356991.1 1718080..1718355(-) (comGC/cglC) [Enterococcus faecalis strain 661]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=648621 LQ066_RS08400 WP_002356991.1 1718080..1718355(-) (comGC/cglC) [Enterococcus faecalis strain 661]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |