Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LZ183_RS08445 | Genome accession | NZ_CP090407 |
| Coordinates | 1743459..1743770 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain GD4SA159-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1738459..1748770
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ183_RS08410 (LZ183_08390) | gcvPA | 1738961..1740307 (-) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| LZ183_RS08415 (LZ183_08395) | gcvT | 1740327..1741418 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LZ183_RS08420 (LZ183_08400) | - | 1741577..1742101 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| LZ183_RS08425 (LZ183_08405) | - | 1742091..1742237 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| LZ183_RS08430 (LZ183_08410) | comGF | 1742334..1742831 (-) | 498 | WP_001825340.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LZ183_RS08435 (LZ183_08415) | comGE | 1742749..1743048 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| LZ183_RS08440 (LZ183_08420) | comGD | 1743035..1743481 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LZ183_RS08445 (LZ183_08425) | comGC | 1743459..1743770 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LZ183_RS08450 (LZ183_08430) | comGB | 1743784..1744854 (-) | 1071 | WP_000776425.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LZ183_RS08455 (LZ183_08435) | comGA | 1744826..1745800 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LZ183_RS08460 (LZ183_08440) | - | 1745852..1746475 (-) | 624 | WP_113587809.1 | MBL fold metallo-hydrolase | - |
| LZ183_RS08465 (LZ183_08445) | - | 1746472..1746801 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| LZ183_RS08470 (LZ183_08450) | - | 1746801..1747787 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| LZ183_RS08475 (LZ183_08455) | - | 1747784..1747987 (-) | 204 | WP_000087559.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=642119 LZ183_RS08445 WP_000472256.1 1743459..1743770(-) (comGC) [Staphylococcus aureus strain GD4SA159-1]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=642119 LZ183_RS08445 WP_000472256.1 1743459..1743770(-) (comGC) [Staphylococcus aureus strain GD4SA159-1]
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |