Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LRS65_RS10560 | Genome accession | NZ_CP089601 |
| Coordinates | 2026734..2027069 (+) | Length | 111 a.a. |
| NCBI ID | WP_000982018.1 | Uniprot ID | A0A9W5VT75 |
| Organism | Bacillus cereus strain C-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1964845..2027069 | 2026734..2027069 | within | 0 |
Gene organization within MGE regions
Location: 1964845..2027069
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRS65_RS10205 (LRS65_10185) | - | 1964845..1965981 (-) | 1137 | WP_257116024.1 | site-specific integrase | - |
| LRS65_RS10210 (LRS65_10190) | - | 1966002..1966520 (-) | 519 | WP_098656329.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LRS65_RS10215 (LRS65_10195) | - | 1967201..1967809 (-) | 609 | WP_000670775.1 | hypothetical protein | - |
| LRS65_RS10220 (LRS65_10200) | - | 1967806..1968399 (-) | 594 | WP_000967383.1 | hypothetical protein | - |
| LRS65_RS10225 (LRS65_10205) | - | 1968368..1969537 (-) | 1170 | WP_000433590.1 | hypothetical protein | - |
| LRS65_RS10230 (LRS65_10210) | - | 1969696..1970067 (-) | 372 | WP_000105316.1 | helix-turn-helix domain-containing protein | - |
| LRS65_RS10235 (LRS65_10215) | - | 1970224..1970481 (+) | 258 | WP_000598018.1 | helix-turn-helix transcriptional regulator | - |
| LRS65_RS10240 (LRS65_10220) | - | 1970490..1970789 (+) | 300 | WP_215571507.1 | helix-turn-helix domain-containing protein | - |
| LRS65_RS10245 (LRS65_10225) | - | 1970857..1971372 (+) | 516 | WP_257116025.1 | helix-turn-helix transcriptional regulator | - |
| LRS65_RS10250 (LRS65_10230) | - | 1971403..1971624 (+) | 222 | WP_000151152.1 | hypothetical protein | - |
| LRS65_RS10255 (LRS65_10235) | - | 1971803..1972087 (+) | 285 | WP_137050449.1 | hypothetical protein | - |
| LRS65_RS10260 (LRS65_10240) | - | 1972205..1973182 (+) | 978 | WP_257116026.1 | DnaD domain protein | - |
| LRS65_RS10265 (LRS65_10245) | - | 1973193..1973555 (+) | 363 | WP_119683270.1 | cell division protein SepF | - |
| LRS65_RS10270 (LRS65_10250) | - | 1973627..1973818 (+) | 192 | WP_257116027.1 | DUF3954 domain-containing protein | - |
| LRS65_RS10275 (LRS65_10255) | - | 1973900..1974574 (-) | 675 | WP_257116028.1 | collagen-like protein | - |
| LRS65_RS10280 (LRS65_10260) | - | 1975128..1975994 (-) | 867 | WP_119683271.1 | exosporium protein D | - |
| LRS65_RS10285 (LRS65_10265) | - | 1976290..1977045 (-) | 756 | WP_257116029.1 | exosporium leader peptide-containing protein | - |
| LRS65_RS10290 (LRS65_10270) | - | 1977326..1977790 (-) | 465 | WP_002163978.1 | hypothetical protein | - |
| LRS65_RS10295 (LRS65_10275) | - | 1978755..1979150 (+) | 396 | WP_257116030.1 | hypothetical protein | - |
| LRS65_RS10300 (LRS65_10280) | - | 1980747..1980908 (+) | 162 | WP_162900585.1 | hypothetical protein | - |
| LRS65_RS10305 (LRS65_10285) | - | 1980936..1981418 (+) | 483 | WP_119683275.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LRS65_RS10310 (LRS65_10290) | - | 1981418..1981960 (+) | 543 | WP_119683276.1 | site-specific integrase | - |
| LRS65_RS10315 (LRS65_10295) | - | 1982326..1983996 (+) | 1671 | WP_240440586.1 | sialidase family protein | - |
| LRS65_RS10320 (LRS65_10300) | - | 1984388..1984606 (+) | 219 | WP_000930975.1 | hypothetical protein | - |
| LRS65_RS10325 (LRS65_10305) | - | 1985032..1985238 (-) | 207 | WP_001068928.1 | hypothetical protein | - |
| LRS65_RS10330 (LRS65_10310) | - | 1985507..1985911 (+) | 405 | WP_063536219.1 | hypothetical protein | - |
| LRS65_RS10335 (LRS65_10315) | - | 1985911..1986126 (+) | 216 | WP_063536220.1 | hypothetical protein | - |
| LRS65_RS10340 (LRS65_10320) | - | 1986286..1986858 (+) | 573 | WP_000576168.1 | recombinase family protein | - |
| LRS65_RS10345 (LRS65_10325) | - | 1986910..1987089 (+) | 180 | WP_257116031.1 | hypothetical protein | - |
| LRS65_RS10350 (LRS65_10330) | terS | 1987111..1987959 (+) | 849 | WP_078420678.1 | phage terminase small subunit | - |
| LRS65_RS10355 (LRS65_10335) | - | 1987952..1989358 (+) | 1407 | WP_078420677.1 | DEAD/DEAH box helicase family protein | - |
| LRS65_RS10360 (LRS65_10340) | - | 1989428..1990903 (+) | 1476 | WP_257116032.1 | phage portal protein | - |
| LRS65_RS10365 (LRS65_10345) | - | 1991017..1991535 (+) | 519 | WP_257116033.1 | phage head morphogenesis protein | - |
| LRS65_RS10370 (LRS65_10350) | - | 1991648..1992850 (+) | 1203 | WP_257116034.1 | XkdF-like putative serine protease domain-containing protein | - |
| LRS65_RS10375 (LRS65_10355) | - | 1992880..1993857 (+) | 978 | WP_106825134.1 | phage major capsid protein | - |
| LRS65_RS10380 (LRS65_10360) | - | 1994028..1994192 (+) | 165 | WP_000869888.1 | YqbF domain-containing protein | - |
| LRS65_RS10385 (LRS65_10365) | - | 1994192..1994728 (+) | 537 | WP_257116035.1 | hypothetical protein | - |
| LRS65_RS10390 (LRS65_10370) | - | 1994725..1995096 (+) | 372 | WP_257116036.1 | hypothetical protein | - |
| LRS65_RS10395 (LRS65_10375) | - | 1995103..1995513 (+) | 411 | WP_000024034.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LRS65_RS10400 (LRS65_10380) | - | 1995517..1995939 (+) | 423 | WP_000063397.1 | hypothetical protein | - |
| LRS65_RS10405 (LRS65_10385) | - | 1995952..1996554 (+) | 603 | WP_000118571.1 | hypothetical protein | - |
| LRS65_RS10410 (LRS65_10390) | - | 1996612..1997142 (+) | 531 | WP_000146557.1 | hypothetical protein | - |
| LRS65_RS10415 (LRS65_10395) | - | 1997094..1997537 (+) | 444 | WP_257116037.1 | hypothetical protein | - |
| LRS65_RS10420 (LRS65_10400) | - | 1997572..1998504 (+) | 933 | Protein_1977 | phage tail tape measure protein | - |
| LRS65_RS10425 (LRS65_10405) | - | 1998935..1999639 (+) | 705 | WP_257116039.1 | hypothetical protein | - |
| LRS65_RS10430 (LRS65_10410) | - | 1999816..2001822 (+) | 2007 | WP_345893699.1 | hypothetical protein | - |
| LRS65_RS10435 (LRS65_10415) | - | 2001819..2002502 (+) | 684 | WP_257116041.1 | hypothetical protein | - |
| LRS65_RS10440 (LRS65_10420) | - | 2002499..2004046 (+) | 1548 | WP_257116042.1 | hypothetical protein | - |
| LRS65_RS10445 (LRS65_10425) | - | 2004057..2004440 (+) | 384 | WP_021727719.1 | hypothetical protein | - |
| LRS65_RS10450 (LRS65_10430) | - | 2004485..2004859 (+) | 375 | WP_257116043.1 | Low copy number virion structural protein | - |
| LRS65_RS10455 (LRS65_10435) | - | 2004872..2005249 (+) | 378 | WP_017673856.1 | hypothetical protein | - |
| LRS65_RS10460 (LRS65_10440) | - | 2005263..2006600 (+) | 1338 | WP_257116044.1 | hypothetical protein | - |
| LRS65_RS10465 (LRS65_10445) | - | 2006614..2008341 (+) | 1728 | WP_061885289.1 | hypothetical protein | - |
| LRS65_RS10470 (LRS65_10450) | - | 2008365..2010590 (+) | 2226 | WP_257116045.1 | hypothetical protein | - |
| LRS65_RS10475 (LRS65_10455) | - | 2010572..2012077 (+) | 1506 | WP_235598831.1 | cell adhesion protein | - |
| LRS65_RS10480 (LRS65_10460) | - | 2012087..2012470 (+) | 384 | WP_061457126.1 | hypothetical protein | - |
| LRS65_RS10485 (LRS65_10465) | - | 2012484..2013404 (+) | 921 | WP_061457127.1 | hypothetical protein | - |
| LRS65_RS10490 (LRS65_10470) | - | 2013713..2014210 (+) | 498 | WP_000439586.1 | phage holin family protein | - |
| LRS65_RS10495 (LRS65_10475) | - | 2014289..2015347 (+) | 1059 | WP_061457128.1 | N-acetylmuramoyl-L-alanine amidase | - |
| LRS65_RS10500 (LRS65_10480) | - | 2015405..2015542 (-) | 138 | WP_170879373.1 | hypothetical protein | - |
| LRS65_RS10505 (LRS65_10485) | - | 2015544..2016632 (-) | 1089 | WP_061457129.1 | hypothetical protein | - |
| LRS65_RS10510 (LRS65_10490) | - | 2017411..2017626 (+) | 216 | WP_061457132.1 | hypothetical protein | - |
| LRS65_RS10515 (LRS65_10495) | - | 2017720..2018010 (+) | 291 | WP_061457133.1 | transposase | - |
| LRS65_RS10520 (LRS65_10500) | - | 2018431..2018751 (-) | 321 | Protein_1997 | transposase | - |
| LRS65_RS10525 (LRS65_10505) | - | 2019693..2020982 (+) | 1290 | WP_257116046.1 | exosporium glycoprotein BclB-related protein | - |
| LRS65_RS10530 (LRS65_10510) | - | 2021254..2021388 (+) | 135 | Protein_1999 | ArpU family transcriptional regulator | - |
| LRS65_RS10535 (LRS65_10515) | - | 2021929..2022756 (-) | 828 | WP_025709741.1 | hypothetical protein | - |
| LRS65_RS10540 (LRS65_10520) | - | 2022866..2023513 (+) | 648 | WP_000165965.1 | HD domain-containing protein | - |
| LRS65_RS10545 (LRS65_10525) | - | 2023510..2025405 (+) | 1896 | WP_257116047.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| LRS65_RS10550 (LRS65_10530) | - | 2025481..2026212 (+) | 732 | WP_025687369.1 | Bax inhibitor-1/YccA family protein | - |
| LRS65_RS10555 (LRS65_10535) | - | 2026318..2026572 (+) | 255 | WP_000975137.1 | DUF4318 domain-containing protein | - |
| LRS65_RS10560 (LRS65_10540) | ssbA | 2026734..2027069 (+) | 336 | WP_000982018.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 111 a.a. Molecular weight: 12771.61 Da Isoelectric Point: 9.4344
>NTDB_id=638307 LRS65_RS10560 WP_000982018.1 2026734..2027069(+) (ssbA) [Bacillus cereus strain C-1]
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS
NYDDEQGKRIYRTEVVIESITFLERRREGAS
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS
NYDDEQGKRIYRTEVVIESITFLERRREGAS
Nucleotide
Download Length: 336 bp
>NTDB_id=638307 LRS65_RS10560 WP_000982018.1 2026734..2027069(+) (ssbA) [Bacillus cereus strain C-1]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGCAAATCGGCTGAGAATGTAACTGAATATTGTAAAAAGGGATCACTCGTTGGGATTACAGGGCGTATTCAGACTAGT
AATTACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCGTAA
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGCAAATCGGCTGAGAATGTAACTGAATATTGTAAAAAGGGATCACTCGTTGGGATTACAGGGCGTATTCAGACTAGT
AATTACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
95.495 |
0.559 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.66 |
95.495 |
0.532 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
50.893 |
100 |
0.514 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
45.714 |
94.595 |
0.432 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.636 |
99.099 |
0.432 |
| ssbA | Streptococcus mutans UA159 |
40 |
99.099 |
0.396 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40 |
99.099 |
0.396 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40 |
99.099 |
0.396 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.091 |
99.099 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.091 |
99.099 |
0.387 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.091 |
99.099 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.091 |
99.099 |
0.387 |