NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	LUY91_RS02840	Genome accession	NZ_CP089495
Coordinates	509479..509790 (+)	Length	103 a.a.
NCBI ID	WP_000472256.1	Uniprot ID	-
Organism	Staphylococcus aureus strain E1202_II_ST496
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 504479..514790

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LUY91_RS02810	-	505262..505465 (+)	204	WP_000087561.1	YqgQ family protein	-
LUY91_RS02815	-	505462..506448 (+)	987	WP_000161314.1	ROK family glucokinase	-
LUY91_RS02820	-	506448..506777 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
LUY91_RS02825	-	506774..507397 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
LUY91_RS02830	comGA	507449..508423 (+)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
LUY91_RS02835	comGB	508395..509465 (+)	1071	WP_000775708.1	competence type IV pilus assembly protein ComGB	Machinery gene
LUY91_RS02840	comGC	509479..509790 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
LUY91_RS02845	comGD	509768..510214 (+)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
LUY91_RS02850	comGE	510201..510500 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
LUY91_RS02855	comGF	510418..510870 (+)	453	WP_111724816.1	competence type IV pilus minor pilin ComGF	Machinery gene
LUY91_RS02860	-	510948..512120 (+)	1173	WP_000195429.1	IS256-like element IS256 family transposase	-
LUY91_RS02865	-	512344..512490 (+)	147	WP_001789879.1	hypothetical protein	-
LUY91_RS02870	-	512480..513004 (+)	525	WP_001015117.1	shikimate kinase	-
LUY91_RS02875	gcvT	513163..514254 (+)	1092	WP_000093351.1	glycine cleavage system aminomethyltransferase GcvT	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268

                                >NTDB_id=637514 LUY91_RS02840 WP_000472256.1 509479..509790(+) (comGC) [Staphylococcus aureus strain E1202_II_ST496]

MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI

KEAQKTCKSGETITISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=637514 LUY91_RS02840 WP_000472256.1 509479..509790(+) (comGC) [Staphylococcus aureus strain E1202_II_ST496]

ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT

AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA

ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA

AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369

Detailed information NTG0637514