NTDB

Overview

Name	pilE	Type	Machinery gene
Locus tag	LRK44_RS04615	Genome accession	NZ_CP088921
Coordinates	1035514..1035954 (-)	Length	146 a.a.
NCBI ID	WP_027490743.1	Uniprot ID	-
Organism	Rhodanobacter denitrificans strain FW104-R3
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1024030..1035447	1035514..1035954	flank	67

Gene organization within MGE regions

Location: 1024030..1035954

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LRK44_RS04570 (LRK44_04570)	-	1024030..1025283 (+)	1254	WP_027490749.1	glycosyltransferase family 4 protein	-
LRK44_RS04575 (LRK44_04575)	-	1025280..1025576 (+)	297	WP_027490748.1	hypothetical protein	-
LRK44_RS04580 (LRK44_04580)	-	1025573..1026523 (+)	951	WP_027490747.1	glycosyltransferase family 2 protein	-
LRK44_RS04585 (LRK44_04585)	-	1026507..1027406 (+)	900	WP_196802029.1	glycosyltransferase	-
LRK44_RS04590 (LRK44_04590)	-	1027466..1028473 (-)	1008	WP_196802028.1	glycosyltransferase	-
LRK44_RS04595 (LRK44_04595)	-	1028470..1029327 (-)	858	WP_196802027.1	class I SAM-dependent methyltransferase	-
LRK44_RS04600 (LRK44_04600)	-	1029824..1031071 (-)	1248	WP_027490746.1	lipopolysaccharide biosynthesis protein	-
LRK44_RS04605 (LRK44_04605)	-	1031471..1033435 (-)	1965	WP_027490745.1	hypothetical protein	-
LRK44_RS04610 (LRK44_04610)	-	1033435..1035447 (-)	2013	WP_027490744.1	hypothetical protein	-
LRK44_RS04615 (LRK44_04615)	pilE	1035514..1035954 (-)	441	WP_027490743.1	pilin	Machinery gene

Sequence

Protein

Download Length: 146 a.a. Molecular weight: 15347.84 Da Isoelectric Point: 10.0547

                                >NTDB_id=633971 LRK44_RS04615 WP_027490743.1 1035514..1035954(-) (pilE) [Rhodanobacter denitrificans strain FW104-R3]

MKKMQKGFTLIELMIVVAIIAILAAIAIPAYQDYLIRTQVSEGAVLTDGAKTAVAEFYSNRGALTNAKNASIGLAQSQSI

NGQYVSKVEVVGGVITASFGGPKANVTALPSSKTFVLSPITQSGSIKWTCTGSTVDQKYLPTSCRK

Nucleotide

Download Length: 441 bp

                                >NTDB_id=633971 LRK44_RS04615 WP_027490743.1 1035514..1035954(-) (pilE) [Rhodanobacter denitrificans strain FW104-R3]

ATGAAGAAGATGCAGAAGGGCTTCACCCTGATCGAACTGATGATCGTGGTCGCGATCATCGCGATCCTCGCCGCGATCGC

CATCCCTGCCTACCAGGATTACCTGATCCGTACGCAGGTGTCCGAGGGCGCGGTGCTGACCGACGGCGCCAAGACGGCCG

TTGCCGAGTTCTACTCGAACCGCGGCGCCCTGACCAATGCCAAGAACGCCAGTATCGGTTTGGCGCAATCCCAAAGTATC

AACGGACAGTACGTCAGCAAAGTTGAGGTTGTGGGTGGCGTCATCACTGCCTCGTTCGGTGGCCCGAAGGCGAACGTGAC

AGCCCTGCCCAGCTCCAAGACTTTCGTGCTCTCCCCCATCACCCAGTCCGGGTCGATCAAGTGGACCTGCACTGGGTCGA

CGGTCGATCAGAAGTACCTGCCAACTTCGTGCCGCAAGTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(37-145)

Prokaryotic N-terminal methylation motif (N_methyl)

(3-27)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilE	Neisseria gonorrhoeae strain FA1090	45.342	100	0.5
pilE	Neisseria gonorrhoeae MS11	43.21	100	0.479
pilA2	Legionella pneumophila strain ERS1305867	47.917	98.63	0.473
pilA2	Legionella pneumophila str. Paris	48.252	97.945	0.473
pilA	Ralstonia pseudosolanacearum GMI1000	40.828	100	0.473
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	34.737	100	0.452
pilA/pilA1	Eikenella corrodens VA1	40.506	100	0.438
comP	Acinetobacter baylyi ADP1	43.537	100	0.438
pilA/pilAI	Pseudomonas stutzeri DSM 10701	38.255	100	0.39
pilA	Acinetobacter baumannii strain A118	37.931	99.315	0.377
pilA	Pseudomonas aeruginosa PAK	34.615	100	0.37

Detailed information NTG0633971