Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | LM507_RS13115 | Genome accession | NZ_CP086726 |
| Coordinates | 2716501..2716776 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain E533 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2716800..2758311 | 2716501..2716776 | flank | 24 |
Gene organization within MGE regions
Location: 2716501..2758311
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LM507_RS13115 (LM507_13115) | comGC/cglC | 2716501..2716776 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LM507_RS13120 (LM507_13120) | comGD | 2716773..2717216 (+) | 444 | WP_025189979.1 | competence type IV pilus minor pilin ComGD | - |
| LM507_RS13125 (LM507_13125) | - | 2717244..2718392 (-) | 1149 | WP_229022057.1 | tyrosine-type recombinase/integrase | - |
| LM507_RS13130 (LM507_13130) | - | 2718489..2719223 (-) | 735 | WP_010820096.1 | ion transporter | - |
| LM507_RS13135 (LM507_13135) | - | 2719257..2719601 (-) | 345 | WP_002395798.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LM507_RS13140 (LM507_13140) | - | 2719618..2719950 (-) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| LM507_RS13145 (LM507_13145) | - | 2720262..2720438 (+) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| LM507_RS13150 (LM507_13150) | - | 2720449..2720760 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| LM507_RS13155 (LM507_13155) | - | 2720767..2720982 (+) | 216 | WP_010783773.1 | hypothetical protein | - |
| LM507_RS13160 (LM507_13160) | - | 2721022..2721345 (+) | 324 | WP_010820095.1 | hypothetical protein | - |
| LM507_RS13165 (LM507_13165) | - | 2721342..2721566 (+) | 225 | WP_002391454.1 | hypothetical protein | - |
| LM507_RS13170 (LM507_13170) | - | 2721669..2722685 (+) | 1017 | WP_010820093.1 | recombinase RecT | - |
| LM507_RS13175 (LM507_13175) | - | 2722648..2723463 (+) | 816 | WP_010783770.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| LM507_RS13180 (LM507_13180) | - | 2723478..2724215 (+) | 738 | WP_104670766.1 | DnaD domain-containing protein | - |
| LM507_RS13185 (LM507_13185) | - | 2724227..2725066 (+) | 840 | WP_010820092.1 | ATP-binding protein | - |
| LM507_RS13190 (LM507_13190) | - | 2725205..2725474 (+) | 270 | WP_010820091.1 | hypothetical protein | - |
| LM507_RS13195 (LM507_13195) | - | 2725623..2726093 (+) | 471 | WP_010709304.1 | DUF1064 domain-containing protein | - |
| LM507_RS13200 (LM507_13200) | - | 2726113..2726718 (+) | 606 | WP_010709305.1 | hypothetical protein | - |
| LM507_RS13205 (LM507_13205) | - | 2726734..2726940 (+) | 207 | WP_016633422.1 | hypothetical protein | - |
| LM507_RS13210 (LM507_13210) | - | 2727603..2728070 (+) | 468 | WP_002373959.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LM507_RS13220 (LM507_13220) | - | 2729083..2730150 (+) | 1068 | WP_010820090.1 | nucleoid-associated protein | - |
| LM507_RS13225 (LM507_13225) | - | 2730152..2731600 (+) | 1449 | WP_010820089.1 | hypothetical protein | - |
| LM507_RS13230 (LM507_13230) | - | 2731669..2731989 (+) | 321 | WP_025189977.1 | hypothetical protein | - |
| LM507_RS13235 (LM507_13235) | - | 2731986..2732297 (+) | 312 | WP_025189976.1 | HNH endonuclease | - |
| LM507_RS13240 (LM507_13240) | - | 2732416..2733087 (+) | 672 | WP_002371590.1 | HNH endonuclease | - |
| LM507_RS13245 (LM507_13245) | - | 2733180..2733491 (+) | 312 | WP_002358082.1 | P27 family phage terminase small subunit | - |
| LM507_RS13250 (LM507_13250) | - | 2733488..2735167 (+) | 1680 | WP_010707158.1 | terminase TerL endonuclease subunit | - |
| LM507_RS13255 (LM507_13255) | - | 2735180..2735347 (+) | 168 | WP_002358079.1 | hypothetical protein | - |
| LM507_RS13260 (LM507_13260) | - | 2735383..2736558 (+) | 1176 | WP_010820087.1 | phage portal protein | - |
| LM507_RS13265 (LM507_13265) | - | 2736536..2737300 (+) | 765 | WP_025189975.1 | head maturation protease, ClpP-related | - |
| LM507_RS13270 (LM507_13270) | - | 2737327..2738472 (+) | 1146 | WP_010820085.1 | phage major capsid protein | - |
| LM507_RS13275 (LM507_13275) | - | 2738550..2738855 (+) | 306 | WP_010820084.1 | hypothetical protein | - |
| LM507_RS13280 (LM507_13280) | - | 2738842..2739216 (+) | 375 | WP_010820083.1 | hypothetical protein | - |
| LM507_RS13285 (LM507_13285) | - | 2739213..2739605 (+) | 393 | WP_010820082.1 | hypothetical protein | - |
| LM507_RS13290 (LM507_13290) | - | 2739602..2739997 (+) | 396 | WP_010820081.1 | hypothetical protein | - |
| LM507_RS13295 (LM507_13295) | - | 2740030..2740623 (+) | 594 | WP_002358071.1 | major tail protein | - |
| LM507_RS13300 (LM507_13300) | - | 2740697..2741170 (+) | 474 | WP_010820080.1 | Ig-like domain-containing protein | - |
| LM507_RS13305 (LM507_13305) | gpG | 2741227..2741574 (+) | 348 | WP_002374163.1 | phage tail assembly chaperone G | - |
| LM507_RS15230 | - | 2741655..2741777 (+) | 123 | WP_002391425.1 | hypothetical protein | - |
| LM507_RS13310 (LM507_13310) | - | 2741796..2746547 (+) | 4752 | WP_010820079.1 | phage tail tape measure protein | - |
| LM507_RS13315 (LM507_13315) | - | 2746547..2747446 (+) | 900 | WP_002371567.1 | phage tail domain-containing protein | - |
| LM507_RS13320 (LM507_13320) | - | 2747449..2748573 (+) | 1125 | WP_025189974.1 | siphovirus ReqiPepy6 Gp37-like family protein | - |
| LM507_RS13325 (LM507_13325) | - | 2748584..2749639 (+) | 1056 | WP_010820077.1 | structural protein | - |
| LM507_RS13330 (LM507_13330) | - | 2749650..2750471 (+) | 822 | WP_010820076.1 | pyocin knob domain-containing protein | - |
| LM507_RS13335 (LM507_13335) | - | 2750534..2750761 (+) | 228 | WP_029655891.1 | hypothetical protein | - |
| LM507_RS13340 (LM507_13340) | - | 2750758..2750964 (+) | 207 | WP_002380792.1 | phage holin | - |
| LM507_RS13345 (LM507_13345) | - | 2750967..2752226 (+) | 1260 | WP_010820075.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LM507_RS13350 (LM507_13350) | - | 2753062..2753262 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| LM507_RS13355 (LM507_13355) | - | 2753335..2753586 (+) | 252 | WP_002364188.1 | hypothetical protein | - |
| LM507_RS13365 (LM507_13365) | hemH | 2754329..2755270 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| LM507_RS13370 (LM507_13370) | - | 2755997..2756398 (+) | 402 | WP_002410542.1 | type II secretion system protein | - |
| LM507_RS13375 (LM507_13375) | comGF | 2756388..2756822 (+) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| LM507_RS13380 (LM507_13380) | comGG | 2756822..2757175 (+) | 354 | WP_010820074.1 | competence type IV pilus minor pilin ComGG | - |
| LM507_RS13385 (LM507_13385) | - | 2757304..2758311 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=626162 LM507_RS13115 WP_002356991.1 2716501..2716776(+) (comGC/cglC) [Enterococcus faecalis strain E533]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=626162 LM507_RS13115 WP_002356991.1 2716501..2716776(+) (comGC/cglC) [Enterococcus faecalis strain E533]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |