NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	LN243_RS07165	Genome accession	NZ_CP086659
Coordinates	1432553..1432864 (+)	Length	103 a.a.
NCBI ID	WP_030063893.1	Uniprot ID	-
Organism	Staphylococcus capitis strain XZ03
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1427553..1437864

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LN243_RS07135	-	1428328..1428531 (+)	204	WP_002433937.1	YqgQ family protein	-
LN243_RS07140	-	1428528..1429514 (+)	987	WP_023350198.1	ROK family glucokinase	-
LN243_RS07145	-	1429514..1429840 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
LN243_RS07150	-	1429840..1430463 (+)	624	WP_023350199.1	MBL fold metallo-hydrolase	-
LN243_RS07155	comGA	1430521..1431495 (+)	975	WP_023350200.1	competence type IV pilus ATPase ComGA	Machinery gene
LN243_RS07160	comGB	1431467..1432534 (+)	1068	WP_023350201.1	competence type IV pilus assembly protein ComGB	-
LN243_RS07165	comGC	1432553..1432864 (+)	312	WP_030063893.1	competence type IV pilus major pilin ComGC	Machinery gene
LN243_RS07170	comGD	1432842..1433291 (+)	450	WP_023350202.1	competence type IV pilus minor pilin ComGD	-
LN243_RS07175	-	1433278..1433577 (+)	300	WP_023350203.1	hypothetical protein	-
LN243_RS07180	comGF	1433495..1433986 (+)	492	WP_037560565.1	competence type IV pilus minor pilin ComGF	-
LN243_RS07190	-	1434156..1434665 (+)	510	WP_029625706.1	shikimate kinase	-
LN243_RS07195	gcvT	1434874..1435965 (+)	1092	WP_023350205.1	glycine cleavage system aminomethyltransferase GcvT	-
LN243_RS07200	gcvPA	1435984..1437330 (+)	1347	WP_023350206.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11344.49 Da Isoelectric Point: 10.2135

                                >NTDB_id=626025 LN243_RS07165 WP_030063893.1 1432553..1432864(+) (comGC) [Staphylococcus capitis strain XZ03]

MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEKLIAEGFI

KEGQKNCKSGQTISISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=626025 LN243_RS07165 WP_030063893.1 1432553..1432864(+) (comGC) [Staphylococcus capitis strain XZ03]

ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT

TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA

ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAAAATTAATTGCTGAAGGTTTTATA

AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus N315	86.408	100	0.864
comGC	Staphylococcus aureus MW2	86.408	100	0.864
comYC	Streptococcus gordonii str. Challis substr. CH1	46.602	100	0.466
comGC/cglC	Streptococcus mitis SK321	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae TIGR4	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae D39	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae R6	45.098	99.029	0.447
comGC/cglC	Streptococcus mitis NCTC 12261	50	83.495	0.417
comYC	Streptococcus mutans UA159	47.727	85.437	0.408
comYC	Streptococcus mutans UA140	47.727	85.437	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Lactococcus lactis subsp. cremoris KW2	49.367	76.699	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.304	89.32	0.369

Detailed information NTG0626025