Detailed information NTG0625584

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LK342_RS07265
• Genome accession: NZ_CP086574
• Coordinates: 1568406..1568717 (-)
• Length: 103 a.a.
• NCBI ID: WP_000921699.1
• Uniprot ID: A0A7U7JUV8
• Organism: Staphylococcus argenteus strain RIVM_M046968
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1563406..1573717

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LK342_RS07230 (LK342_07230)	gcvPA	1563909..1565255 (-)	1347	WP_047526704.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
LK342_RS07235 (LK342_07235)	gcvT	1565274..1566365 (-)	1092	WP_047526706.1	glycine cleavage system aminomethyltransferase GcvT	-
LK342_RS07240 (LK342_07240)	-	1566522..1567046 (-)	525	WP_047526708.1	shikimate kinase	-
LK342_RS07245 (LK342_07245)	-	1567033..1567182 (-)	150	WP_072292059.1	hypothetical protein	-
LK342_RS07250 (LK342_07250)	comGF	1567281..1567736 (-)	456	WP_078377685.1	competence type IV pilus minor pilin ComGF	Machinery gene
LK342_RS07255 (LK342_07255)	comGE	1567696..1567995 (-)	300	WP_000800819.1	hypothetical protein	Machinery gene
LK342_RS07260 (LK342_07260)	comGD	1567982..1568428 (-)	447	WP_072292023.1	competence type IV pilus minor pilin ComGD	Machinery gene
LK342_RS07265 (LK342_07265)	comGC	1568406..1568717 (-)	312	WP_000921699.1	competence type IV pilus major pilin ComGC	Machinery gene
LK342_RS07270 (LK342_07270)	comGB	1568732..1569802 (-)	1071	WP_047434565.1	competence type IV pilus assembly protein ComGB	Machinery gene
LK342_RS07275 (LK342_07275)	comGA	1569774..1570748 (-)	975	WP_031787262.1	competence type IV pilus ATPase ComGA	Machinery gene
LK342_RS07280 (LK342_07280)	-	1570800..1571423 (-)	624	WP_001222932.1	MBL fold metallo-hydrolase	-
LK342_RS07285 (LK342_07285)	-	1571420..1571749 (-)	330	WP_001018874.1	MTH1187 family thiamine-binding protein	-
LK342_RS07290 (LK342_07290)	-	1571749..1572735 (-)	987	WP_000161316.1	ROK family glucokinase	-
LK342_RS07295 (LK342_07295)	-	1572735..1572935 (-)	201	WP_000087563.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11189.29 Da
• Isoelectric Point: 9.1992

>NTDB_id=625584 LK342_RS07265 WP_000921699.1 1568406..1568717(-) (comGC) [Staphylococcus argenteus strain RIVM_M046968]
MLKVIKKAKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIDELVADGFI
KEAQKTCKSGETISISNGEAIAN

Nucleotide

• Length: 312 bp

>NTDB_id=625584 LK342_RS07265 WP_000921699.1 1568406..1568717(-) (comGC) [Staphylococcus argenteus strain RIVM_M046968]
ATGTTGAAAGTTATTAAAAAAGCTAAAGCATTTACTTTAATAGAAATGCTATTAGTTCTATTAATTATAAGCTTATTATT
AATTTTAATTATTCCAAATATCGCGAAACAAACAGCGCATATCCAATCTACTGGATGTAATGCACAAGTTAAAATGGTTA
ATAGTCAAATTGAAGCTTATGCATTGAAACACAATAGAAATCCTTCTTCAATTGATGAATTAGTAGCTGATGGCTTTATT
AAAGAGGCGCAAAAAACATGTAAATCTGGTGAAACAATATCGATTAGTAATGGAGAAGCTATTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A7U7JUV8

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	90.291	100	0.903
comGC	Staphylococcus aureus N315	90.291	100	0.903
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	43.878	95.146	0.417
comYC	Streptococcus mutans UA159	48.235	82.524	0.398
comYC	Streptococcus mutans UA140	48.235	82.524	0.398
comYC	Streptococcus suis isolate S10	51.282	75.728	0.388
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	79.612	0.388
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369