Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | LM510_RS09815 | Genome accession | NZ_CP086560 |
| Coordinates | 2008572..2008847 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain E509 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1959672..2008548 | 2008572..2008847 | flank | 24 |
Gene organization within MGE regions
Location: 1959672..2008847
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LM510_RS09490 (LM510_09480) | - | 1959672..1961885 (-) | 2214 | WP_002357079.1 | RelA/SpoT family protein | - |
| LM510_RS09495 (LM510_09485) | - | 1962100..1962852 (-) | 753 | WP_002378439.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| LM510_RS09500 (LM510_09490) | prmA | 1962854..1963801 (-) | 948 | WP_002371999.1 | 50S ribosomal protein L11 methyltransferase | - |
| LM510_RS09505 (LM510_09495) | - | 1963817..1964302 (-) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| LM510_RS09510 (LM510_09500) | - | 1964259..1964936 (-) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| LM510_RS09515 (LM510_09505) | - | 1965065..1966342 (+) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| LM510_RS09525 (LM510_09515) | - | 1966616..1966948 (+) | 333 | WP_002357068.1 | hypothetical protein | - |
| LM510_RS09530 (LM510_09520) | - | 1967264..1967737 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| LM510_RS09535 (LM510_09525) | - | 1967849..1969036 (-) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| LM510_RS09540 (LM510_09530) | - | 1969061..1970068 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| LM510_RS09545 (LM510_09535) | comGG | 1970197..1970550 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| LM510_RS09550 (LM510_09540) | comGF | 1970550..1970984 (-) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| LM510_RS09555 (LM510_09545) | - | 1970974..1971300 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| LM510_RS09560 (LM510_09550) | hemH | 1972101..1973042 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| LM510_RS09570 (LM510_09560) | - | 1973758..1974030 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| LM510_RS09575 (LM510_09565) | - | 1974102..1974302 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| LM510_RS09580 (LM510_09570) | - | 1975155..1976414 (-) | 1260 | WP_002378445.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LM510_RS09585 (LM510_09575) | - | 1976427..1976807 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| LM510_RS09590 (LM510_09580) | - | 1976818..1976940 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| LM510_RS09595 (LM510_09585) | - | 1976942..1977337 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| LM510_RS09600 (LM510_09590) | - | 1977356..1977808 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| LM510_RS09605 (LM510_09595) | - | 1977825..1978565 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| LM510_RS09610 (LM510_09600) | - | 1978571..1980016 (-) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| LM510_RS09615 (LM510_09605) | - | 1980016..1980738 (-) | 723 | WP_002363380.1 | hypothetical protein | - |
| LM510_RS09620 (LM510_09610) | - | 1980735..1985189 (-) | 4455 | WP_002378448.1 | phage tail tape measure protein | - |
| LM510_RS09625 (LM510_09615) | - | 1985176..1985481 (-) | 306 | WP_002366371.1 | hypothetical protein | - |
| LM510_RS09630 (LM510_09620) | - | 1985550..1985948 (-) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| LM510_RS09635 (LM510_09625) | - | 1986002..1986574 (-) | 573 | WP_002401805.1 | immunoglobulin-like domain-containing protein | - |
| LM510_RS09640 (LM510_09630) | - | 1986623..1986805 (-) | 183 | WP_002378453.1 | hypothetical protein | - |
| LM510_RS09645 (LM510_09635) | - | 1986808..1987413 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| LM510_RS09650 (LM510_09640) | - | 1987432..1987824 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| LM510_RS09655 (LM510_09645) | - | 1987821..1988159 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LM510_RS09660 (LM510_09650) | - | 1988156..1988431 (-) | 276 | WP_002378454.1 | hypothetical protein | - |
| LM510_RS09665 (LM510_09655) | - | 1988428..1988760 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| LM510_RS09670 (LM510_09660) | - | 1988831..1989727 (-) | 897 | WP_002378455.1 | hypothetical protein | - |
| LM510_RS09675 (LM510_09665) | - | 1989741..1990376 (-) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| LM510_RS09680 (LM510_09670) | - | 1990499..1991425 (-) | 927 | WP_002378457.1 | minor capsid protein | - |
| LM510_RS09685 (LM510_09675) | - | 1991418..1992902 (-) | 1485 | WP_002378458.1 | phage portal protein | - |
| LM510_RS09690 (LM510_09680) | - | 1992902..1994185 (-) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| LM510_RS09695 (LM510_09685) | - | 1994166..1994600 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| LM510_RS09700 (LM510_09690) | - | 1994632..1994862 (-) | 231 | Protein_1883 | hypothetical protein | - |
| LM510_RS09705 (LM510_09695) | - | 1995333..1995695 (-) | 363 | WP_224800088.1 | hypothetical protein | - |
| LM510_RS09710 (LM510_09700) | - | 1995812..1996720 (-) | 909 | WP_002378460.1 | hypothetical protein | - |
| LM510_RS09720 (LM510_09710) | - | 1997435..1997851 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LM510_RS09725 (LM510_09715) | - | 1998759..1999166 (-) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LM510_RS09730 (LM510_09720) | - | 1999163..2000020 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| LM510_RS09735 (LM510_09725) | - | 2000020..2000220 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| LM510_RS09740 (LM510_09730) | - | 2000225..2000866 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| LM510_RS09745 (LM510_09735) | - | 2000871..2001605 (-) | 735 | WP_002378463.1 | ERF family protein | - |
| LM510_RS09750 (LM510_09740) | - | 2001598..2001915 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| LM510_RS09755 (LM510_09745) | - | 2002135..2002689 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| LM510_RS09760 (LM510_09750) | - | 2003116..2003310 (-) | 195 | WP_002378464.1 | hypothetical protein | - |
| LM510_RS09765 (LM510_09755) | - | 2003347..2003556 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| LM510_RS09770 (LM510_09760) | - | 2003611..2003799 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| LM510_RS09775 (LM510_09765) | - | 2003825..2004550 (-) | 726 | WP_002378466.1 | Rha family transcriptional regulator | - |
| LM510_RS09780 (LM510_09770) | - | 2004589..2004900 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| LM510_RS09785 (LM510_09775) | - | 2004911..2005087 (-) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| LM510_RS09790 (LM510_09780) | - | 2005399..2005731 (+) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| LM510_RS09795 (LM510_09785) | - | 2005748..2006092 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LM510_RS09800 (LM510_09790) | - | 2006128..2006856 (+) | 729 | WP_002378468.1 | ion transporter | - |
| LM510_RS09805 (LM510_09795) | - | 2006956..2008104 (+) | 1149 | WP_002378469.1 | tyrosine-type recombinase/integrase | - |
| LM510_RS09810 (LM510_09800) | comGD | 2008141..2008575 (-) | 435 | Protein_1904 | competence type IV pilus minor pilin ComGD | - |
| LM510_RS09815 (LM510_09805) | comGC/cglC | 2008572..2008847 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=625386 LM510_RS09815 WP_002356991.1 2008572..2008847(-) (comGC/cglC) [Enterococcus faecalis strain E509]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=625386 LM510_RS09815 WP_002356991.1 2008572..2008847(-) (comGC/cglC) [Enterococcus faecalis strain E509]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |