Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | LJ570_RS05220 | Genome accession | NZ_CP085841 |
| Coordinates | 1088179..1088454 (+) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain FA2-2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1088478..1141941 | 1088179..1088454 | flank | 24 |
Gene organization within MGE regions
Location: 1088179..1141941
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJ570_RS05220 (LJ570_05215) | comGC/cglC | 1088179..1088454 (+) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LJ570_RS05225 (LJ570_05220) | comGD | 1088451..1088894 (+) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| LJ570_RS05230 (LJ570_05225) | - | 1088922..1090070 (-) | 1149 | WP_002389015.1 | tyrosine-type recombinase/integrase | - |
| LJ570_RS05235 (LJ570_05230) | - | 1090145..1090474 (-) | 330 | WP_002369911.1 | hypothetical protein | - |
| LJ570_RS05240 (LJ570_05235) | - | 1090489..1091253 (-) | 765 | WP_002389030.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LJ570_RS05245 (LJ570_05240) | - | 1091371..1092018 (-) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LJ570_RS05250 (LJ570_05245) | - | 1092023..1092367 (-) | 345 | WP_002384346.1 | helix-turn-helix domain-containing protein | - |
| LJ570_RS05255 (LJ570_05250) | - | 1092658..1092849 (+) | 192 | WP_002356998.1 | hypothetical protein | - |
| LJ570_RS05260 (LJ570_05255) | - | 1092855..1093172 (+) | 318 | WP_002364228.1 | hypothetical protein | - |
| LJ570_RS05265 (LJ570_05260) | - | 1093211..1093933 (+) | 723 | WP_002364225.1 | Rha family transcriptional regulator | - |
| LJ570_RS05270 (LJ570_05265) | - | 1093973..1094155 (-) | 183 | WP_002364224.1 | YegP family protein | - |
| LJ570_RS05275 (LJ570_05270) | - | 1094208..1094402 (+) | 195 | WP_002364223.1 | hypothetical protein | - |
| LJ570_RS05280 (LJ570_05275) | - | 1094393..1094578 (+) | 186 | WP_002364222.1 | hypothetical protein | - |
| LJ570_RS05285 (LJ570_05280) | - | 1094622..1094945 (+) | 324 | WP_002369793.1 | hypothetical protein | - |
| LJ570_RS05290 (LJ570_05285) | - | 1094945..1095172 (+) | 228 | WP_002364220.1 | hypothetical protein | - |
| LJ570_RS05295 (LJ570_05290) | - | 1095270..1096211 (+) | 942 | WP_002364219.1 | YqaJ viral recombinase family protein | - |
| LJ570_RS05300 (LJ570_05295) | - | 1096214..1097104 (+) | 891 | WP_002364218.1 | recombinase RecT | - |
| LJ570_RS05305 (LJ570_05300) | - | 1097118..1098080 (+) | 963 | WP_002392261.1 | Lin1244/Lin1753 domain-containing protein | - |
| LJ570_RS05310 (LJ570_05305) | - | 1098084..1098386 (+) | 303 | WP_002364215.1 | hypothetical protein | - |
| LJ570_RS05315 (LJ570_05310) | - | 1098387..1098686 (+) | 300 | WP_002392260.1 | MazG-like family protein | - |
| LJ570_RS05320 (LJ570_05315) | - | 1098704..1099127 (+) | 424 | Protein_1025 | RusA family crossover junction endodeoxyribonuclease | - |
| LJ570_RS05325 (LJ570_05320) | - | 1100034..1100450 (+) | 417 | WP_002364209.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LJ570_RS05335 (LJ570_05330) | - | 1100981..1101595 (+) | 615 | WP_002384355.1 | hypothetical protein | - |
| LJ570_RS05340 (LJ570_05335) | - | 1102312..1103034 (+) | 723 | WP_002392259.1 | DUF5677 domain-containing protein | - |
| LJ570_RS05345 (LJ570_05340) | terS | 1103081..1103884 (+) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| LJ570_RS05350 (LJ570_05345) | - | 1103856..1105145 (+) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| LJ570_RS05355 (LJ570_05350) | - | 1105157..1106644 (+) | 1488 | WP_002384358.1 | phage portal protein | - |
| LJ570_RS05360 (LJ570_05355) | - | 1106619..1108376 (+) | 1758 | WP_002392258.1 | head protein | - |
| LJ570_RS05365 (LJ570_05360) | - | 1108373..1108594 (+) | 222 | WP_002357027.1 | hypothetical protein | - |
| LJ570_RS05370 (LJ570_05365) | - | 1108659..1108979 (+) | 321 | WP_002389265.1 | hypothetical protein | - |
| LJ570_RS05375 (LJ570_05370) | - | 1109197..1109820 (+) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| LJ570_RS05380 (LJ570_05375) | - | 1109834..1110721 (+) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| LJ570_RS05385 (LJ570_05380) | - | 1110750..1110932 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| LJ570_RS05390 (LJ570_05385) | - | 1110946..1111290 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| LJ570_RS05395 (LJ570_05390) | - | 1111287..1111655 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| LJ570_RS14085 | - | 1111648..1111731 (+) | 84 | Protein_1040 | HK97 gp10 family phage protein | - |
| LJ570_RS05400 (LJ570_05395) | - | 1111869..1113119 (-) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| LJ570_RS05405 (LJ570_05400) | - | 1113473..1113817 (+) | 345 | WP_002392208.1 | HK97 gp10 family phage protein | - |
| LJ570_RS05410 (LJ570_05405) | - | 1113820..1114194 (+) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| LJ570_RS05415 (LJ570_05410) | - | 1114195..1115043 (+) | 849 | WP_002384363.1 | major tail protein | - |
| LJ570_RS05420 (LJ570_05415) | gpG | 1115096..1115446 (+) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| LJ570_RS05425 (LJ570_05420) | - | 1115694..1118591 (+) | 2898 | WP_002392207.1 | tape measure protein | - |
| LJ570_RS05430 (LJ570_05425) | - | 1118581..1119315 (+) | 735 | WP_002357042.1 | hypothetical protein | - |
| LJ570_RS05435 (LJ570_05430) | - | 1119297..1122104 (+) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| LJ570_RS05440 (LJ570_05435) | - | 1122123..1123004 (+) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| LJ570_RS05445 (LJ570_05440) | - | 1122997..1123593 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| LJ570_RS05450 (LJ570_05445) | - | 1123590..1123877 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| LJ570_RS05455 (LJ570_05450) | - | 1123877..1124368 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| LJ570_RS05460 (LJ570_05455) | - | 1124382..1124702 (+) | 321 | WP_010774127.1 | hypothetical protein | - |
| LJ570_RS05465 (LJ570_05460) | - | 1124704..1124859 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| LJ570_RS05470 (LJ570_05465) | - | 1124894..1125115 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| LJ570_RS05475 (LJ570_05470) | - | 1125108..1125341 (+) | 234 | WP_002384371.1 | phage holin | - |
| LJ570_RS05480 (LJ570_05475) | - | 1125342..1126583 (+) | 1242 | WP_002392204.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LJ570_RS05485 (LJ570_05480) | - | 1127448..1127648 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| LJ570_RS05490 (LJ570_05485) | - | 1127720..1127992 (+) | 273 | WP_002370964.1 | hypothetical protein | - |
| LJ570_RS05500 (LJ570_05495) | hemH | 1128708..1129649 (+) | 942 | WP_033606971.1 | ferrochelatase | - |
| LJ570_RS05505 (LJ570_05500) | - | 1130451..1130777 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| LJ570_RS05510 (LJ570_05505) | comGF | 1130767..1131201 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| LJ570_RS05515 (LJ570_05510) | comGG | 1131201..1131554 (+) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| LJ570_RS05520 (LJ570_05515) | - | 1131683..1132690 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| LJ570_RS05525 (LJ570_05520) | - | 1132715..1133902 (+) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| LJ570_RS05530 (LJ570_05525) | - | 1134014..1134487 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| LJ570_RS05535 (LJ570_05530) | - | 1134665..1134943 (-) | 279 | WP_002380425.1 | hypothetical protein | - |
| LJ570_RS05545 (LJ570_05540) | - | 1135271..1136548 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| LJ570_RS05550 (LJ570_05545) | - | 1136677..1137354 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| LJ570_RS05555 (LJ570_05550) | - | 1137311..1137796 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| LJ570_RS05560 (LJ570_05555) | prmA | 1137812..1138759 (+) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| LJ570_RS05565 (LJ570_05560) | - | 1138761..1139513 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| LJ570_RS05570 (LJ570_05565) | - | 1139728..1141941 (+) | 2214 | WP_002357079.1 | RelA/SpoT family protein | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=620746 LJ570_RS05220 WP_002364235.1 1088179..1088454(+) (comGC/cglC) [Enterococcus faecalis strain FA2-2]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=620746 LJ570_RS05220 WP_002364235.1 1088179..1088454(+) (comGC/cglC) [Enterococcus faecalis strain FA2-2]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |