Detailed information NTG0617079

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: NUU05_RS01645
• Genome accession: NZ_CP102538
• Coordinates: 295935..296261 (+)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain TH-4
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 290935..301261

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NUU05_RS01630 (NUU05_01620)	-	293572..293934 (+)	363	WP_011226630.1	DUF1033 family protein	-
NUU05_RS01635 (NUU05_01625)	comGA/cglA/cilD	294015..294956 (+)	942	WP_011681689.1	competence type IV pilus ATPase ComGA	Machinery gene
NUU05_RS01640 (NUU05_01630)	comGB	294838..295938 (+)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
NUU05_RS01645 (NUU05_01635)	comGC	295935..296261 (+)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
NUU05_RS01650 (NUU05_01640)	comGD	296221..296649 (+)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
NUU05_RS01655 (NUU05_01645)	comGE	296621..296914 (+)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
NUU05_RS01660 (NUU05_01650)	comGF	296898..297335 (+)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
NUU05_RS01665 (NUU05_01655)	comGG	297313..297630 (+)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	Machinery gene
NUU05_RS01670 (NUU05_01660)	comGH	297675..298631 (+)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
NUU05_RS01675 (NUU05_01665)	-	298687..299880 (+)	1194	WP_014608740.1	acetate kinase	-
NUU05_RS01680 (NUU05_01670)	-	300129..300326 (+)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
NUU05_RS01685 (NUU05_01675)	-	300338..300613 (+)	276	WP_011681681.1	hypothetical protein	-
NUU05_RS01690 (NUU05_01680)	-	300657..300995 (+)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=617079 NUU05_RS01645 WP_002946126.1 295935..296261(+) (comGC) [Streptococcus thermophilus strain TH-4]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=617079 NUU05_RS01645 WP_002946126.1 295935..296261(+) (comGC) [Streptococcus thermophilus strain TH-4]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Streptococcus mutans UA140	69.231	96.296	0.667
comGC	Streptococcus mutans UA159	69.231	96.296	0.667
comGC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comGC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361