Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | LIT96_RS12060 | Genome accession | NZ_CP085291 |
| Coordinates | 2495054..2495329 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EFS36 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2495353..2538372 | 2495054..2495329 | flank | 24 |
Gene organization within MGE regions
Location: 2495054..2538372
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIT96_RS12060 (LIT96_12060) | comGC/cglC | 2495054..2495329 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LIT96_RS12065 (LIT96_12065) | comGD | 2495326..2495769 (+) | 444 | WP_002369912.1 | competence type IV pilus minor pilin ComGD | - |
| LIT96_RS12070 (LIT96_12070) | - | 2495797..2496945 (-) | 1149 | WP_002389015.1 | site-specific integrase | - |
| LIT96_RS12075 (LIT96_12075) | - | 2497020..2497349 (-) | 330 | WP_002369911.1 | hypothetical protein | - |
| LIT96_RS12080 (LIT96_12080) | - | 2497364..2498128 (-) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| LIT96_RS12085 (LIT96_12085) | - | 2498246..2498884 (-) | 639 | WP_002389292.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LIT96_RS12090 (LIT96_12090) | - | 2498897..2499241 (-) | 345 | WP_002385819.1 | helix-turn-helix domain-containing protein | - |
| LIT96_RS12095 (LIT96_12095) | - | 2499532..2499723 (+) | 192 | WP_002356998.1 | hypothetical protein | - |
| LIT96_RS12100 (LIT96_12100) | - | 2499729..2500046 (+) | 318 | WP_002364228.1 | hypothetical protein | - |
| LIT96_RS12105 (LIT96_12105) | - | 2500085..2500805 (+) | 721 | Protein_2359 | ORF6C domain-containing protein | - |
| LIT96_RS12110 (LIT96_12110) | - | 2500845..2501027 (-) | 183 | WP_002364224.1 | YegP family protein | - |
| LIT96_RS12115 (LIT96_12115) | - | 2501080..2501274 (+) | 195 | WP_002364223.1 | hypothetical protein | - |
| LIT96_RS12120 (LIT96_12120) | - | 2501265..2501450 (+) | 186 | WP_002364222.1 | hypothetical protein | - |
| LIT96_RS12125 (LIT96_12125) | - | 2501494..2501817 (+) | 324 | WP_002369793.1 | hypothetical protein | - |
| LIT96_RS12130 (LIT96_12130) | - | 2501817..2502044 (+) | 228 | WP_002364220.1 | hypothetical protein | - |
| LIT96_RS12135 (LIT96_12135) | - | 2502142..2503086 (+) | 945 | WP_002389314.1 | YqaJ viral recombinase family protein | - |
| LIT96_RS12140 (LIT96_12140) | - | 2503086..2503979 (+) | 894 | WP_002369907.1 | recombinase RecT | - |
| LIT96_RS12145 (LIT96_12145) | - | 2504016..2505016 (+) | 1001 | Protein_2367 | Lin1244/Lin1753 domain-containing protein | - |
| LIT96_RS12150 (LIT96_12150) | - | 2505020..2505271 (+) | 252 | WP_227316500.1 | hypothetical protein | - |
| LIT96_RS12155 (LIT96_12155) | - | 2505325..2505624 (+) | 300 | WP_002389080.1 | MazG-like family protein | - |
| LIT96_RS12160 (LIT96_12160) | - | 2505642..2506067 (+) | 426 | WP_002389212.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LIT96_RS12165 (LIT96_12165) | - | 2506974..2507390 (+) | 417 | WP_010816133.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LIT96_RS12175 (LIT96_12175) | - | 2508384..2508617 (+) | 234 | WP_002389079.1 | hypothetical protein | - |
| LIT96_RS12180 (LIT96_12180) | - | 2508761..2509339 (+) | 579 | WP_002370953.1 | sce7726 family protein | - |
| LIT96_RS12185 (LIT96_12185) | - | 2509377..2510294 (-) | 918 | WP_002370955.1 | beta family protein | - |
| LIT96_RS12190 (LIT96_12190) | terS | 2510563..2511366 (+) | 804 | WP_002389117.1 | phage terminase small subunit | - |
| LIT96_RS12195 (LIT96_12195) | - | 2511338..2512627 (+) | 1290 | WP_002403123.1 | PBSX family phage terminase large subunit | - |
| LIT96_RS12200 (LIT96_12200) | - | 2512639..2514126 (+) | 1488 | WP_002384358.1 | phage portal protein | - |
| LIT96_RS12205 (LIT96_12205) | - | 2514101..2515858 (+) | 1758 | WP_002384360.1 | head protein | - |
| LIT96_RS12210 (LIT96_12210) | - | 2515855..2516076 (+) | 222 | WP_002357027.1 | hypothetical protein | - |
| LIT96_RS12215 (LIT96_12215) | - | 2516141..2516461 (+) | 321 | WP_002389265.1 | hypothetical protein | - |
| LIT96_RS12220 (LIT96_12220) | - | 2516679..2517302 (+) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| LIT96_RS12225 (LIT96_12225) | - | 2517354..2518202 (+) | 849 | WP_050396210.1 | DUF5309 domain-containing protein | - |
| LIT96_RS12230 (LIT96_12230) | - | 2518231..2518413 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| LIT96_RS12235 (LIT96_12235) | - | 2518427..2518771 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| LIT96_RS12240 (LIT96_12240) | - | 2518768..2519136 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| LIT96_RS12245 (LIT96_12245) | - | 2519129..2519527 (+) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| LIT96_RS12250 (LIT96_12250) | - | 2519530..2519904 (+) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| LIT96_RS12255 (LIT96_12255) | - | 2519905..2520753 (+) | 849 | WP_002384363.1 | major tail protein | - |
| LIT96_RS12260 (LIT96_12260) | gpG | 2520806..2521156 (+) | 351 | WP_002370959.1 | phage tail assembly chaperone G | - |
| LIT96_RS12265 (LIT96_12265) | - | 2521404..2524301 (+) | 2898 | WP_002393612.1 | tape measure protein | - |
| LIT96_RS12270 (LIT96_12270) | - | 2524291..2525025 (+) | 735 | WP_002357042.1 | hypothetical protein | - |
| LIT96_RS12275 (LIT96_12275) | - | 2525007..2527814 (+) | 2808 | WP_227316501.1 | phage tail spike protein | - |
| LIT96_RS12280 (LIT96_12280) | - | 2527833..2528714 (+) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| LIT96_RS12285 (LIT96_12285) | - | 2528707..2529303 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| LIT96_RS12290 (LIT96_12290) | - | 2529300..2529587 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| LIT96_RS12295 (LIT96_12295) | - | 2529587..2530078 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| LIT96_RS12300 (LIT96_12300) | - | 2530092..2530412 (+) | 321 | WP_002389262.1 | hypothetical protein | - |
| LIT96_RS12305 (LIT96_12305) | - | 2530414..2530569 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| LIT96_RS12310 (LIT96_12310) | - | 2530604..2530825 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| LIT96_RS12315 (LIT96_12315) | - | 2530818..2531051 (+) | 234 | WP_002384371.1 | phage holin | - |
| LIT96_RS12320 (LIT96_12320) | - | 2531052..2532293 (+) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LIT96_RS12325 (LIT96_12325) | - | 2533130..2533330 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| LIT96_RS12330 (LIT96_12330) | - | 2533402..2533674 (+) | 273 | WP_002370964.1 | hypothetical protein | - |
| LIT96_RS12340 (LIT96_12340) | hemH | 2534390..2535331 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| LIT96_RS12345 (LIT96_12345) | - | 2536133..2536459 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| LIT96_RS12350 (LIT96_12350) | comGF | 2536449..2536883 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| LIT96_RS12355 (LIT96_12355) | comGG | 2536883..2537236 (+) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| LIT96_RS12360 (LIT96_12360) | - | 2537365..2538372 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=617079 LIT96_RS12060 WP_002356991.1 2495054..2495329(+) (comGC/cglC) [Enterococcus faecalis strain EFS36]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=617079 LIT96_RS12060 WP_002356991.1 2495054..2495329(+) (comGC/cglC) [Enterococcus faecalis strain EFS36]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |