Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | LIT95_RS00495 | Genome accession | NZ_CP085289 |
| Coordinates | 79105..79380 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EFS17 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 26811..97485 | 79105..79380 | within | 0 |
Gene organization within MGE regions
Location: 26811..97485
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIT95_RS00145 (LIT95_00145) | - | 26811..29024 (-) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
| LIT95_RS00150 (LIT95_00150) | - | 29239..29991 (-) | 753 | WP_002370972.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| LIT95_RS00155 (LIT95_00155) | prmA | 29993..30940 (-) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| LIT95_RS00160 (LIT95_00160) | - | 30956..31441 (-) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| LIT95_RS00165 (LIT95_00165) | - | 31398..32075 (-) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| LIT95_RS00170 (LIT95_00170) | - | 32204..33481 (+) | 1278 | WP_002370971.1 | replication-associated recombination protein A | - |
| LIT95_RS00180 (LIT95_00180) | - | 33809..34087 (+) | 279 | WP_002380425.1 | hypothetical protein | - |
| LIT95_RS00185 (LIT95_00185) | - | 34265..34738 (+) | 474 | WP_002370968.1 | universal stress protein | - |
| LIT95_RS00190 (LIT95_00190) | - | 34850..36037 (-) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| LIT95_RS00195 (LIT95_00195) | - | 36062..37069 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| LIT95_RS00200 (LIT95_00200) | comGG | 37198..37551 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| LIT95_RS00205 (LIT95_00205) | comGF | 37551..37985 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| LIT95_RS00210 (LIT95_00210) | - | 37975..38301 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| LIT95_RS00215 (LIT95_00215) | hemH | 39103..40044 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| LIT95_RS00225 (LIT95_00225) | - | 40760..41032 (-) | 273 | WP_002370964.1 | hypothetical protein | - |
| LIT95_RS00230 (LIT95_00230) | - | 41104..41304 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| LIT95_RS00235 (LIT95_00235) | - | 42141..43382 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LIT95_RS00240 (LIT95_00240) | - | 43383..43616 (-) | 234 | WP_002384371.1 | phage holin | - |
| LIT95_RS00245 (LIT95_00245) | - | 43609..43830 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| LIT95_RS00250 (LIT95_00250) | - | 43865..44020 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| LIT95_RS00255 (LIT95_00255) | - | 44022..44342 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| LIT95_RS00260 (LIT95_00260) | - | 44356..44847 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| LIT95_RS00265 (LIT95_00265) | - | 44847..45134 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| LIT95_RS00270 (LIT95_00270) | - | 45131..45727 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| LIT95_RS00275 (LIT95_00275) | - | 45720..46601 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| LIT95_RS00280 (LIT95_00280) | - | 46620..49427 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| LIT95_RS00285 (LIT95_00285) | - | 49409..50143 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| LIT95_RS00290 (LIT95_00290) | - | 50133..53030 (-) | 2898 | WP_002393612.1 | tape measure protein | - |
| LIT95_RS00295 (LIT95_00295) | gpG | 53278..53628 (-) | 351 | WP_227264193.1 | phage tail assembly chaperone G | - |
| LIT95_RS00300 (LIT95_00300) | - | 53681..54529 (-) | 849 | WP_227264194.1 | major tail protein | - |
| LIT95_RS00305 (LIT95_00305) | - | 54530..54904 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| LIT95_RS00310 (LIT95_00310) | - | 54907..55305 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| LIT95_RS00315 (LIT95_00315) | - | 55298..55666 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| LIT95_RS00320 (LIT95_00320) | - | 55663..56007 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| LIT95_RS00325 (LIT95_00325) | - | 56021..56203 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| LIT95_RS00330 (LIT95_00330) | - | 56232..57080 (-) | 849 | WP_050396210.1 | DUF5309 domain-containing protein | - |
| LIT95_RS00335 (LIT95_00335) | - | 57132..57755 (-) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| LIT95_RS00340 (LIT95_00340) | - | 57973..58293 (-) | 321 | WP_002389265.1 | hypothetical protein | - |
| LIT95_RS00345 (LIT95_00345) | - | 58358..58579 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| LIT95_RS00350 (LIT95_00350) | - | 58576..60333 (-) | 1758 | WP_002384360.1 | head protein | - |
| LIT95_RS00355 (LIT95_00355) | - | 60308..61795 (-) | 1488 | WP_002384358.1 | phage portal protein | - |
| LIT95_RS00360 (LIT95_00360) | - | 61807..63096 (-) | 1290 | WP_002403123.1 | PBSX family phage terminase large subunit | - |
| LIT95_RS00365 (LIT95_00365) | terS | 63068..63871 (-) | 804 | WP_002389117.1 | phage terminase small subunit | - |
| LIT95_RS00370 (LIT95_00370) | - | 64140..65057 (+) | 918 | WP_002370955.1 | beta family protein | - |
| LIT95_RS00375 (LIT95_00375) | - | 65095..65673 (-) | 579 | WP_002370953.1 | sce7726 family protein | - |
| LIT95_RS00380 (LIT95_00380) | - | 65817..66050 (-) | 234 | WP_002389079.1 | hypothetical protein | - |
| LIT95_RS00390 (LIT95_00390) | - | 67044..67460 (-) | 417 | WP_010816133.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LIT95_RS00395 (LIT95_00395) | - | 68367..68792 (-) | 426 | WP_002389212.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LIT95_RS00400 (LIT95_00400) | - | 68810..69109 (-) | 300 | WP_002389080.1 | MazG-like family protein | - |
| LIT95_RS00405 (LIT95_00405) | - | 69110..69412 (-) | 303 | WP_002389299.1 | hypothetical protein | - |
| LIT95_RS00410 (LIT95_00410) | - | 69416..70417 (-) | 1002 | WP_002389256.1 | Lin1244/Lin1753 domain-containing protein | - |
| LIT95_RS00415 (LIT95_00415) | - | 70454..71347 (-) | 894 | WP_002369907.1 | recombinase RecT | - |
| LIT95_RS00420 (LIT95_00420) | - | 71347..72291 (-) | 945 | WP_002389314.1 | YqaJ viral recombinase family protein | - |
| LIT95_RS00425 (LIT95_00425) | - | 72389..72616 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| LIT95_RS00430 (LIT95_00430) | - | 72616..72939 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| LIT95_RS00435 (LIT95_00435) | - | 72983..73168 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| LIT95_RS00440 (LIT95_00440) | - | 73159..73353 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| LIT95_RS00445 (LIT95_00445) | - | 73406..73588 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| LIT95_RS00450 (LIT95_00450) | - | 73628..74349 (-) | 722 | Protein_86 | Rha family transcriptional regulator | - |
| LIT95_RS00455 (LIT95_00455) | - | 74388..74705 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| LIT95_RS00460 (LIT95_00460) | - | 74711..74902 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| LIT95_RS00465 (LIT95_00465) | - | 75193..75537 (+) | 345 | WP_002385819.1 | helix-turn-helix domain-containing protein | - |
| LIT95_RS00470 (LIT95_00470) | - | 75550..76188 (+) | 639 | WP_002389292.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LIT95_RS00475 (LIT95_00475) | - | 76306..77070 (+) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| LIT95_RS00480 (LIT95_00480) | - | 77085..77414 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| LIT95_RS00485 (LIT95_00485) | - | 77489..78637 (+) | 1149 | WP_002389015.1 | site-specific integrase | - |
| LIT95_RS00490 (LIT95_00490) | comGD | 78665..79108 (-) | 444 | WP_002369912.1 | competence type IV pilus minor pilin ComGD | - |
| LIT95_RS00495 (LIT95_00495) | comGC/cglC | 79105..79380 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LIT95_RS00500 (LIT95_00500) | comGB | 79380..80426 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| LIT95_RS00505 (LIT95_00505) | comGA | 80383..81351 (-) | 969 | WP_002369913.1 | competence type IV pilus ATPase ComGA | - |
| LIT95_RS00510 (LIT95_00510) | - | 81591..82919 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| LIT95_RS00515 (LIT95_00515) | rlmN | 83209..84282 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| LIT95_RS00520 (LIT95_00520) | - | 84407..86236 (-) | 1830 | WP_002403116.1 | ABC transporter permease | - |
| LIT95_RS00525 (LIT95_00525) | - | 86226..86975 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| LIT95_RS00530 (LIT95_00530) | - | 87093..87794 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| LIT95_RS00535 (LIT95_00535) | - | 87925..90348 (-) | 2424 | WP_002369916.1 | DNA translocase FtsK | - |
| LIT95_RS00540 (LIT95_00540) | - | 90662..91873 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| LIT95_RS00545 (LIT95_00545) | - | 91902..92807 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| LIT95_RS00550 (LIT95_00550) | - | 92929..93909 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| LIT95_RS00555 (LIT95_00555) | cydC | 93989..95755 (-) | 1767 | WP_002369917.1 | thiol reductant ABC exporter subunit CydC | - |
| LIT95_RS00560 (LIT95_00560) | cydD | 95752..97485 (-) | 1734 | WP_002369918.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=617011 LIT95_RS00495 WP_002356991.1 79105..79380(-) (comGC/cglC) [Enterococcus faecalis strain EFS17]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=617011 LIT95_RS00495 WP_002356991.1 79105..79380(-) (comGC/cglC) [Enterococcus faecalis strain EFS17]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |