Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | RSAU_RS07490 | Genome accession | NC_022222 |
| Coordinates | 1528389..1528700 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus subsp. aureus 6850 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1523389..1533700
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RSAU_RS07455 (RSAU_001402) | gcvPA | 1523891..1525237 (-) | 1347 | WP_020977293.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| RSAU_RS07460 (RSAU_001403) | gcvT | 1525257..1526348 (-) | 1092 | WP_020977294.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RSAU_RS07465 (RSAU_001404) | - | 1526507..1527031 (-) | 525 | WP_020977295.1 | shikimate kinase | - |
| RSAU_RS07470 | - | 1527021..1527167 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| RSAU_RS07475 (RSAU_001405) | comGF | 1527264..1527761 (-) | 498 | WP_020977296.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| RSAU_RS07480 | comGE | 1527679..1527978 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| RSAU_RS07485 (RSAU_001406) | comGD | 1527965..1528411 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| RSAU_RS07490 (RSAU_001407) | comGC | 1528389..1528700 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| RSAU_RS07495 (RSAU_001408) | comGB | 1528714..1529784 (-) | 1071 | WP_000776407.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| RSAU_RS07500 (RSAU_001409) | comGA | 1529756..1530730 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| RSAU_RS07505 (RSAU_001410) | - | 1530782..1531405 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| RSAU_RS07510 (RSAU_001411) | - | 1531402..1531731 (-) | 330 | WP_020977297.1 | MTH1187 family thiamine-binding protein | - |
| RSAU_RS07515 (RSAU_001412) | - | 1531731..1532717 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| RSAU_RS07520 (RSAU_001413) | - | 1532714..1532917 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=61326 RSAU_RS07490 WP_000472256.1 1528389..1528700(-) (comGC) [Staphylococcus aureus subsp. aureus 6850]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=61326 RSAU_RS07490 WP_000472256.1 1528389..1528700(-) (comGC) [Staphylococcus aureus subsp. aureus 6850]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |