Detailed information NTG0607227

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: K3A99_RS07645
• Genome accession: NZ_CP083671
• Coordinates: 1594385..1594696 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain HL25870
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1589385..1599696

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
K3A99_RS07610 (K3A99_001504)	gcvPA	1589887..1591233 (-)	1347	WP_000019698.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
K3A99_RS07615 (K3A99_001505)	gcvT	1591253..1592344 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
K3A99_RS07620 (K3A99_001506)	-	1592503..1593027 (-)	525	WP_001015120.1	shikimate kinase	-
K3A99_RS07625 (K3A99_001507)	-	1593017..1593163 (-)	147	WP_001789879.1	hypothetical protein	-
K3A99_RS07630 (K3A99_001508)	comGF	1593260..1593757 (-)	498	WP_001825340.1	competence type IV pilus minor pilin ComGF	Machinery gene
K3A99_RS07635 (K3A99_001509)	comGE	1593675..1593974 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
K3A99_RS07640 (K3A99_001510)	comGD	1593961..1594407 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
K3A99_RS07645 (K3A99_001511)	comGC	1594385..1594696 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
K3A99_RS07650 (K3A99_001512)	comGB	1594710..1595780 (-)	1071	WP_000776425.1	competence type IV pilus assembly protein ComGB	Machinery gene
K3A99_RS07655 (K3A99_001513)	comGA	1595752..1596726 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
K3A99_RS07660 (K3A99_001514)	-	1596778..1597401 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
K3A99_RS07665 (K3A99_001515)	-	1597398..1597727 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
K3A99_RS07670 (K3A99_001516)	-	1597727..1598713 (-)	987	WP_000161315.1	ROK family glucokinase	-
K3A99_RS07675 (K3A99_001517)	-	1598710..1598913 (-)	204	WP_000087559.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=607227 K3A99_RS07645 WP_000472256.1 1594385..1594696(-) (comGC) [Staphylococcus aureus strain HL25870]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=607227 K3A99_RS07645 WP_000472256.1 1594385..1594696(-) (comGC) [Staphylococcus aureus strain HL25870]
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369