NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	K8Z38_RS09765	Genome accession	NZ_CP083144
Coordinates	1894253..1894585 (+)	Length	110 a.a.
NCBI ID	WP_001082769.1	Uniprot ID	A0A9W5QHQ8
Organism	Bacillus thuringiensis strain GC-91
Function	ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	1872857..1896479	1894253..1894585	within	0

Gene organization within MGE regions

Location: 1872857..1896479

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
K8Z38_RS09720 (K8Z38_09680)	-	1873918..1876647 (+)	2730	WP_021728047.1	hypothetical protein	-
K8Z38_RS09725 (K8Z38_09685)	-	1876650..1878401 (+)	1752	WP_021729424.1	phage integrase	-
K8Z38_RS09730 (K8Z38_09690)	-	1878394..1879110 (+)	717	WP_021728389.1	hypothetical protein	-
K8Z38_RS09735 (K8Z38_09695)	-	1879871..1883593 (+)	3723	WP_042991544.1	ATP-binding protein	-
K8Z38_RS09740 (K8Z38_09700)	-	1884048..1885415 (-)	1368	WP_021728391.1	hypothetical protein	-
K8Z38_RS09745 (K8Z38_09705)	-	1885593..1885820 (+)	228	WP_021728392.1	helix-turn-helix domain-containing protein	-
K8Z38_RS09750 (K8Z38_09710)	-	1886213..1886434 (+)	222	WP_021728393.1	hypothetical protein	-
K8Z38_RS09755 (K8Z38_09715)	-	1887188..1887457 (-)	270	Protein_1900	GNAT family N-acetyltransferase	-
K8Z38_RS09760 (K8Z38_09720)	-	1887871..1893873 (+)	6003	WP_021728395.1	ATP-binding protein	-
K8Z38_RS09765 (K8Z38_09725)	ssbA	1894253..1894585 (+)	333	WP_001082769.1	single-stranded DNA-binding protein	Machinery gene
K8Z38_RS09770 (K8Z38_09730)	-	1894922..1895482 (-)	561	WP_000714949.1	AAA family ATPase	-

Sequence

Protein

Download Length: 110 a.a. Molecular weight: 12610.39 Da Isoelectric Point: 9.4344

                                >NTDB_id=604830 K8Z38_RS09765 WP_001082769.1 1894253..1894585(+) (ssbA) [Bacillus thuringiensis strain GC-91]

MNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQTSN

YDDEQGKRIYRTEVVIESITFLERRREGAS

Nucleotide

Download Length: 333 bp

                                >NTDB_id=604830 K8Z38_RS09765 WP_001082769.1 1894253..1894585(+) (ssbA) [Bacillus thuringiensis strain GC-91]

TTGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGCACG

AATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTTGGC

GCAAATCGGCTGAGAATGTAGCTGAATATTGTAAGAAGGGGTCGCTCGTTGGGATTACAGGGCGTATTCAGACTAGTAAT

TACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCGGGA

GGGGGCATCGTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(1-102)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	59.048	95.455	0.564
ssb	Latilactobacillus sakei subsp. sakei 23K	56.19	95.455	0.536
ssbB	Bacillus subtilis subsp. subtilis str. 168	51.351	100	0.518
ssbB	Lactococcus lactis subsp. cremoris KW2	45.714	95.455	0.436
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.519	98.182	0.427
ssbA	Streptococcus mutans UA159	40.741	98.182	0.4
ssbB/cilA	Streptococcus mitis NCTC 12261	40.741	98.182	0.4
ssbB/cilA	Streptococcus pneumoniae TIGR4	40.741	98.182	0.4
ssbB/cilA	Streptococcus pneumoniae D39	39.815	98.182	0.391
ssbB/cilA	Streptococcus pneumoniae R6	39.815	98.182	0.391
ssbB/cilA	Streptococcus mitis SK321	39.815	98.182	0.391
ssbB/cilA	Streptococcus pneumoniae Rx1	39.815	98.182	0.391

Detailed information NTG0604830