Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | K4752_RS05225 | Genome accession | NZ_CP081505 |
| Coordinates | 1088175..1088450 (+) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain E006xJH2-2-TC1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1088474..1141937 | 1088175..1088450 | flank | 24 |
Gene organization within MGE regions
Location: 1088175..1141937
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K4752_RS05225 (K4752_05225) | comGC/cglC | 1088175..1088450 (+) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| K4752_RS05230 (K4752_05230) | comGD | 1088447..1088890 (+) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| K4752_RS05235 (K4752_05235) | - | 1088918..1090066 (-) | 1149 | WP_002389015.1 | tyrosine-type recombinase/integrase | - |
| K4752_RS05240 (K4752_05240) | - | 1090141..1090470 (-) | 330 | WP_002369911.1 | hypothetical protein | - |
| K4752_RS05245 (K4752_05245) | - | 1090485..1091249 (-) | 765 | WP_002389030.1 | LysM peptidoglycan-binding domain-containing protein | - |
| K4752_RS05250 (K4752_05250) | - | 1091367..1092014 (-) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| K4752_RS05255 (K4752_05255) | - | 1092019..1092363 (-) | 345 | WP_002384346.1 | helix-turn-helix domain-containing protein | - |
| K4752_RS05260 (K4752_05260) | - | 1092654..1092845 (+) | 192 | WP_002356998.1 | hypothetical protein | - |
| K4752_RS05265 (K4752_05265) | - | 1092851..1093168 (+) | 318 | WP_002364228.1 | hypothetical protein | - |
| K4752_RS05270 (K4752_05270) | - | 1093207..1093929 (+) | 723 | WP_002364225.1 | Rha family transcriptional regulator | - |
| K4752_RS05275 (K4752_05275) | - | 1093969..1094151 (-) | 183 | WP_002364224.1 | YegP family protein | - |
| K4752_RS05280 (K4752_05280) | - | 1094204..1094398 (+) | 195 | WP_002364223.1 | hypothetical protein | - |
| K4752_RS05285 (K4752_05285) | - | 1094389..1094574 (+) | 186 | WP_002364222.1 | hypothetical protein | - |
| K4752_RS05290 (K4752_05290) | - | 1094618..1094941 (+) | 324 | WP_002369793.1 | hypothetical protein | - |
| K4752_RS05295 (K4752_05295) | - | 1094941..1095168 (+) | 228 | WP_002364220.1 | hypothetical protein | - |
| K4752_RS05300 (K4752_05300) | - | 1095266..1096207 (+) | 942 | WP_002364219.1 | YqaJ viral recombinase family protein | - |
| K4752_RS05305 (K4752_05305) | - | 1096210..1097100 (+) | 891 | WP_002364218.1 | recombinase RecT | - |
| K4752_RS05310 (K4752_05310) | - | 1097114..1098076 (+) | 963 | WP_002392261.1 | Lin1244/Lin1753 domain-containing protein | - |
| K4752_RS05315 (K4752_05315) | - | 1098080..1098382 (+) | 303 | WP_002364215.1 | hypothetical protein | - |
| K4752_RS05320 (K4752_05320) | - | 1098383..1098682 (+) | 300 | WP_002392260.1 | MazG-like family protein | - |
| K4752_RS05325 (K4752_05325) | - | 1098700..1099123 (+) | 424 | Protein_1027 | RusA family crossover junction endodeoxyribonuclease | - |
| K4752_RS05330 (K4752_05330) | - | 1099402..1099662 (+) | 261 | WP_002357017.1 | hypothetical protein | - |
| K4752_RS05335 (K4752_05335) | - | 1100030..1100446 (+) | 417 | WP_002364209.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| K4752_RS05345 (K4752_05345) | - | 1100977..1101591 (+) | 615 | WP_002384355.1 | hypothetical protein | - |
| K4752_RS05350 (K4752_05350) | - | 1102308..1103030 (+) | 723 | WP_002392259.1 | DUF5677 domain-containing protein | - |
| K4752_RS05355 (K4752_05355) | terS | 1103077..1103880 (+) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| K4752_RS05360 (K4752_05360) | - | 1103852..1105141 (+) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| K4752_RS05365 (K4752_05365) | - | 1105153..1106640 (+) | 1488 | WP_002384358.1 | phage portal protein | - |
| K4752_RS05370 (K4752_05370) | - | 1106615..1108372 (+) | 1758 | WP_002392258.1 | head protein | - |
| K4752_RS05375 (K4752_05375) | - | 1108381..1108590 (+) | 210 | WP_002389354.1 | hypothetical protein | - |
| K4752_RS05380 (K4752_05380) | - | 1108655..1108975 (+) | 321 | WP_002389265.1 | hypothetical protein | - |
| K4752_RS05385 (K4752_05385) | - | 1109193..1109816 (+) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| K4752_RS05390 (K4752_05390) | - | 1109830..1110717 (+) | 888 | WP_002392257.1 | DUF5309 domain-containing protein | - |
| K4752_RS05395 (K4752_05395) | - | 1110746..1110928 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| K4752_RS05400 (K4752_05400) | - | 1110942..1111286 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| K4752_RS05405 (K4752_05405) | - | 1111283..1111651 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| K4752_RS14965 | - | 1111644..1111727 (+) | 84 | Protein_1043 | HK97 gp10 family phage protein | - |
| K4752_RS05410 (K4752_05410) | - | 1111865..1113115 (-) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| K4752_RS05415 (K4752_05415) | - | 1113469..1113813 (+) | 345 | WP_002392208.1 | HK97 gp10 family phage protein | - |
| K4752_RS05420 (K4752_05420) | - | 1113816..1114190 (+) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| K4752_RS05425 (K4752_05425) | - | 1114191..1115039 (+) | 849 | WP_002384363.1 | major tail protein | - |
| K4752_RS05430 (K4752_05430) | gpG | 1115092..1115442 (+) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| K4752_RS05435 (K4752_05435) | - | 1115690..1118587 (+) | 2898 | WP_002392207.1 | tape measure protein | - |
| K4752_RS05440 (K4752_05440) | - | 1118577..1119311 (+) | 735 | WP_002357042.1 | hypothetical protein | - |
| K4752_RS05445 (K4752_05445) | - | 1119293..1122100 (+) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| K4752_RS05450 (K4752_05450) | - | 1122119..1123000 (+) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| K4752_RS05455 (K4752_05455) | - | 1122993..1123589 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| K4752_RS05460 (K4752_05460) | - | 1123586..1123873 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| K4752_RS05465 (K4752_05465) | - | 1123873..1124364 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| K4752_RS05470 (K4752_05470) | - | 1124378..1124698 (+) | 321 | WP_010774127.1 | hypothetical protein | - |
| K4752_RS05475 (K4752_05475) | - | 1124700..1124855 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| K4752_RS05480 (K4752_05480) | - | 1124890..1125111 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| K4752_RS05485 (K4752_05485) | - | 1125104..1125337 (+) | 234 | WP_002384371.1 | phage holin | - |
| K4752_RS05490 (K4752_05490) | - | 1125338..1126579 (+) | 1242 | WP_002392204.1 | LysM peptidoglycan-binding domain-containing protein | - |
| K4752_RS05495 (K4752_05495) | - | 1127444..1127644 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| K4752_RS05500 (K4752_05500) | - | 1127716..1127988 (+) | 273 | WP_002370964.1 | hypothetical protein | - |
| K4752_RS05510 (K4752_05510) | hemH | 1128704..1129645 (+) | 942 | WP_033606971.1 | ferrochelatase | - |
| K4752_RS05515 (K4752_05515) | - | 1130447..1130773 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| K4752_RS05520 (K4752_05520) | comGF | 1130763..1131197 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| K4752_RS05525 (K4752_05525) | comGG | 1131197..1131550 (+) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| K4752_RS05530 (K4752_05530) | - | 1131679..1132686 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| K4752_RS05535 (K4752_05535) | - | 1132711..1133898 (+) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| K4752_RS05540 (K4752_05540) | - | 1134010..1134483 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| K4752_RS05545 (K4752_05545) | - | 1134661..1134939 (-) | 279 | WP_002380425.1 | hypothetical protein | - |
| K4752_RS05555 (K4752_05555) | - | 1135267..1136544 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| K4752_RS05560 (K4752_05560) | - | 1136673..1137350 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| K4752_RS05565 (K4752_05565) | - | 1137307..1137792 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| K4752_RS05570 (K4752_05570) | prmA | 1137808..1138755 (+) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| K4752_RS05575 (K4752_05575) | - | 1138757..1139509 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| K4752_RS05580 (K4752_05580) | - | 1139724..1141937 (+) | 2214 | WP_002357079.1 | RelA/SpoT family protein | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=597096 K4752_RS05225 WP_002364235.1 1088175..1088450(+) (comGC/cglC) [Enterococcus faecalis strain E006xJH2-2-TC1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=597096 K4752_RS05225 WP_002364235.1 1088175..1088450(+) (comGC/cglC) [Enterococcus faecalis strain E006xJH2-2-TC1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |