Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | K2228_RS09030 | Genome accession | NZ_CP080759 |
| Coordinates | 1805206..1805481 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain M817 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1761700..1805182 | 1805206..1805481 | flank | 24 |
Gene organization within MGE regions
Location: 1761700..1805481
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K2228_RS08715 (K2228_08675) | - | 1761700..1762707 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| K2228_RS08720 (K2228_08680) | comGG | 1762836..1763189 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| K2228_RS08725 (K2228_08685) | comGF | 1763189..1763623 (-) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| K2228_RS08730 (K2228_08690) | - | 1763613..1764014 (-) | 402 | WP_002410542.1 | type II secretion system protein | - |
| K2228_RS14410 | - | 1764318..1764443 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| K2228_RS08735 (K2228_08695) | hemH | 1764741..1765682 (-) | 942 | WP_116491831.1 | ferrochelatase | - |
| K2228_RS08745 (K2228_08705) | - | 1766004..1766825 (-) | 822 | WP_114232967.1 | DUF3800 domain-containing protein | - |
| K2228_RS08750 (K2228_08710) | - | 1767450..1768751 (-) | 1302 | WP_114232968.1 | LysM peptidoglycan-binding domain-containing protein | - |
| K2228_RS08755 (K2228_08715) | - | 1768754..1768960 (-) | 207 | WP_114232969.1 | phage holin | - |
| K2228_RS08760 (K2228_08720) | - | 1768957..1769178 (-) | 222 | WP_002397443.1 | hypothetical protein | - |
| K2228_RS08765 (K2228_08725) | - | 1769206..1769361 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| K2228_RS08770 (K2228_08730) | - | 1769363..1769683 (-) | 321 | WP_002388445.1 | hypothetical protein | - |
| K2228_RS08775 (K2228_08735) | - | 1769697..1770188 (-) | 492 | WP_010711694.1 | hypothetical protein | - |
| K2228_RS08780 (K2228_08740) | - | 1770188..1770466 (-) | 279 | WP_116491832.1 | hypothetical protein | - |
| K2228_RS08785 (K2228_08745) | - | 1770463..1771059 (-) | 597 | WP_116491833.1 | hypothetical protein | - |
| K2228_RS08790 (K2228_08750) | - | 1771052..1771933 (-) | 882 | WP_116491834.1 | phage baseplate upper protein | - |
| K2228_RS08795 (K2228_08755) | - | 1771952..1774759 (-) | 2808 | WP_164549299.1 | phage tail spike protein | - |
| K2228_RS08800 (K2228_08760) | - | 1774741..1775475 (-) | 735 | WP_104670712.1 | phage tail protein | - |
| K2228_RS08805 (K2228_08765) | - | 1775465..1778362 (-) | 2898 | WP_164549302.1 | tape measure protein | - |
| K2228_RS08810 (K2228_08770) | - | 1778610..1778960 (-) | 351 | WP_010820912.1 | hypothetical protein | - |
| K2228_RS08815 (K2228_08775) | - | 1779012..1779860 (-) | 849 | WP_002387287.1 | major tail protein | - |
| K2228_RS08820 (K2228_08780) | - | 1779861..1780235 (-) | 375 | WP_116491837.1 | DUF6838 family protein | - |
| K2228_RS08825 (K2228_08785) | - | 1780238..1780636 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| K2228_RS08830 (K2228_08790) | - | 1780629..1781003 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| K2228_RS08835 (K2228_08795) | - | 1781000..1781344 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| K2228_RS08840 (K2228_08800) | - | 1781358..1781540 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| K2228_RS08845 (K2228_08805) | - | 1781569..1782456 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| K2228_RS08850 (K2228_08810) | - | 1782470..1783093 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| K2228_RS08855 (K2228_08815) | - | 1783312..1783632 (-) | 321 | WP_116491838.1 | hypothetical protein | - |
| K2228_RS08860 (K2228_08820) | - | 1783689..1783919 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| K2228_RS08865 (K2228_08825) | - | 1783920..1785821 (-) | 1902 | WP_116491839.1 | head protein | - |
| K2228_RS08870 (K2228_08830) | - | 1785799..1787271 (-) | 1473 | WP_116491840.1 | phage portal protein | - |
| K2228_RS08875 (K2228_08835) | terL | 1787283..1788671 (-) | 1389 | WP_164549303.1 | phage terminase large subunit | - |
| K2228_RS08880 (K2228_08840) | - | 1788664..1789125 (-) | 462 | WP_002399680.1 | helix-turn-helix domain-containing protein | - |
| K2228_RS08885 (K2228_08845) | - | 1789156..1789386 (-) | 231 | WP_114232998.1 | hypothetical protein | - |
| K2228_RS08895 (K2228_08855) | - | 1790227..1790643 (-) | 417 | WP_116491841.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| K2228_RS08900 (K2228_08860) | - | 1791017..1791223 (-) | 207 | WP_116491842.1 | hypothetical protein | - |
| K2228_RS08905 (K2228_08865) | - | 1791237..1791821 (-) | 585 | WP_010711679.1 | DUF3850 domain-containing protein | - |
| K2228_RS08910 (K2228_08870) | - | 1791833..1792081 (-) | 249 | WP_002415426.1 | hypothetical protein | - |
| K2228_RS08915 (K2228_08875) | - | 1792078..1792431 (-) | 354 | WP_002415427.1 | hypothetical protein | - |
| K2228_RS08920 (K2228_08880) | - | 1792581..1793339 (-) | 759 | WP_025191955.1 | N-6 DNA methylase | - |
| K2228_RS08925 (K2228_08885) | - | 1793392..1793562 (-) | 171 | WP_033603020.1 | hypothetical protein | - |
| K2228_RS08930 (K2228_08890) | - | 1793626..1794054 (-) | 429 | WP_164549300.1 | RusA family crossover junction endodeoxyribonuclease | - |
| K2228_RS08935 (K2228_08895) | - | 1794051..1795004 (-) | 954 | WP_116491844.1 | phage replisome organizer N-terminal domain-containing protein | - |
| K2228_RS08940 (K2228_08900) | - | 1795008..1795688 (-) | 681 | WP_116491845.1 | putative HNHc nuclease | - |
| K2228_RS08945 (K2228_08905) | - | 1795685..1796623 (-) | 939 | WP_116491846.1 | DUF1351 domain-containing protein | - |
| K2228_RS08950 (K2228_08910) | - | 1796608..1797285 (-) | 678 | WP_116491847.1 | ERF family protein | - |
| K2228_RS08955 (K2228_08915) | - | 1797278..1797523 (-) | 246 | WP_116491848.1 | hypothetical protein | - |
| K2228_RS08960 (K2228_08920) | - | 1797703..1798026 (-) | 324 | WP_002368201.1 | hypothetical protein | - |
| K2228_RS08965 (K2228_08925) | - | 1798099..1798842 (-) | 744 | WP_002368200.1 | hypothetical protein | - |
| K2228_RS08970 (K2228_08930) | - | 1798855..1799262 (-) | 408 | WP_002363338.1 | hypothetical protein | - |
| K2228_RS08975 (K2228_08935) | - | 1799331..1799531 (-) | 201 | WP_116491849.1 | hypothetical protein | - |
| K2228_RS08980 (K2228_08940) | - | 1799542..1799727 (-) | 186 | WP_099704312.1 | hypothetical protein | - |
| K2228_RS08985 (K2228_08945) | - | 1799738..1800450 (-) | 713 | Protein_1750 | Rha family transcriptional regulator | - |
| K2228_RS08990 (K2228_08950) | - | 1800489..1800806 (-) | 318 | WP_002356999.1 | hypothetical protein | - |
| K2228_RS08995 (K2228_08955) | - | 1800812..1801003 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| K2228_RS09000 (K2228_08960) | - | 1801296..1801637 (+) | 342 | WP_002396615.1 | helix-turn-helix transcriptional regulator | - |
| K2228_RS09005 (K2228_08965) | - | 1801642..1802289 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| K2228_RS09010 (K2228_08970) | - | 1802407..1803171 (+) | 765 | WP_229077509.1 | LysM domain-containing protein | - |
| K2228_RS09015 (K2228_08975) | - | 1803186..1803515 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| K2228_RS09020 (K2228_08980) | - | 1803590..1804738 (+) | 1149 | WP_116491852.1 | site-specific integrase | - |
| K2228_RS09025 (K2228_08985) | comGD | 1804766..1805209 (-) | 444 | WP_116491816.1 | competence type IV pilus minor pilin ComGD | - |
| K2228_RS09030 (K2228_08990) | comGC/cglC | 1805206..1805481 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=594685 K2228_RS09030 WP_002356991.1 1805206..1805481(-) (comGC/cglC) [Enterococcus faecalis strain M817]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=594685 K2228_RS09030 WP_002356991.1 1805206..1805481(-) (comGC/cglC) [Enterococcus faecalis strain M817]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |