Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | KUO14_RS09285 | Genome accession | NZ_CP078015 |
| Coordinates | 1858439..1858714 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain SY-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1814932..1858415 | 1858439..1858714 | flank | 24 |
Gene organization within MGE regions
Location: 1814932..1858714
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KUO14_RS08975 (KUO14_08975) | - | 1814932..1815939 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| KUO14_RS08980 (KUO14_08980) | comGG | 1816068..1816421 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| KUO14_RS08985 (KUO14_08985) | comGF | 1816421..1816855 (-) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| KUO14_RS08990 (KUO14_08990) | - | 1816845..1817216 (-) | 372 | WP_171025395.1 | type II secretion system protein | - |
| KUO14_RS14400 | - | 1817550..1817675 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| KUO14_RS08995 (KUO14_08995) | hemH | 1817973..1818914 (-) | 942 | WP_116491831.1 | ferrochelatase | - |
| KUO14_RS09005 (KUO14_09005) | - | 1819236..1820045 (-) | 810 | WP_159162083.1 | DUF3800 domain-containing protein | - |
| KUO14_RS09010 (KUO14_09010) | - | 1820682..1821983 (-) | 1302 | WP_114232968.1 | LysM peptidoglycan-binding domain-containing protein | - |
| KUO14_RS09015 (KUO14_09015) | - | 1821986..1822192 (-) | 207 | WP_114232969.1 | phage holin | - |
| KUO14_RS09020 (KUO14_09020) | - | 1822189..1822410 (-) | 222 | WP_002397443.1 | hypothetical protein | - |
| KUO14_RS09025 (KUO14_09025) | - | 1822438..1822593 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| KUO14_RS09030 (KUO14_09030) | - | 1822595..1822915 (-) | 321 | WP_002388445.1 | hypothetical protein | - |
| KUO14_RS09035 (KUO14_09035) | - | 1822929..1823420 (-) | 492 | WP_010711694.1 | hypothetical protein | - |
| KUO14_RS09040 (KUO14_09040) | - | 1823420..1823698 (-) | 279 | WP_116491832.1 | hypothetical protein | - |
| KUO14_RS09045 (KUO14_09045) | - | 1823695..1824291 (-) | 597 | WP_116491833.1 | hypothetical protein | - |
| KUO14_RS09050 (KUO14_09050) | - | 1824284..1825165 (-) | 882 | WP_116491834.1 | phage baseplate upper protein | - |
| KUO14_RS09055 (KUO14_09055) | - | 1825184..1827991 (-) | 2808 | WP_164549299.1 | phage tail spike protein | - |
| KUO14_RS09060 (KUO14_09060) | - | 1827973..1828707 (-) | 735 | WP_104670712.1 | phage tail protein | - |
| KUO14_RS09065 (KUO14_09065) | - | 1828697..1831594 (-) | 2898 | WP_164549302.1 | tape measure protein | - |
| KUO14_RS09070 (KUO14_09070) | gpG | 1831842..1832192 (-) | 351 | WP_010820912.1 | phage tail assembly chaperone G | - |
| KUO14_RS09075 (KUO14_09075) | - | 1832244..1833092 (-) | 849 | WP_002387287.1 | major tail protein | - |
| KUO14_RS09080 (KUO14_09080) | - | 1833093..1833467 (-) | 375 | WP_116491837.1 | DUF6838 family protein | - |
| KUO14_RS09085 (KUO14_09085) | - | 1833470..1833868 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| KUO14_RS09090 (KUO14_09090) | - | 1833861..1834235 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| KUO14_RS09095 (KUO14_09095) | - | 1834232..1834576 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| KUO14_RS09100 (KUO14_09100) | - | 1834590..1834772 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| KUO14_RS09105 (KUO14_09105) | - | 1834801..1835688 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| KUO14_RS09110 (KUO14_09110) | - | 1835702..1836325 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| KUO14_RS09115 (KUO14_09115) | - | 1836544..1836864 (-) | 321 | WP_116491838.1 | hypothetical protein | - |
| KUO14_RS09120 (KUO14_09120) | - | 1836921..1837151 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| KUO14_RS09125 (KUO14_09125) | - | 1837152..1839053 (-) | 1902 | WP_116491839.1 | head protein | - |
| KUO14_RS09130 (KUO14_09130) | - | 1839031..1840503 (-) | 1473 | WP_116491840.1 | phage portal protein | - |
| KUO14_RS09135 (KUO14_09135) | terL | 1840515..1841903 (-) | 1389 | WP_164549303.1 | phage terminase large subunit | - |
| KUO14_RS09140 (KUO14_09140) | - | 1841896..1842357 (-) | 462 | WP_002399680.1 | helix-turn-helix domain-containing protein | - |
| KUO14_RS09145 (KUO14_09145) | - | 1842388..1842618 (-) | 231 | WP_114232998.1 | hypothetical protein | - |
| KUO14_RS09155 (KUO14_09155) | - | 1843459..1843875 (-) | 417 | WP_116491841.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| KUO14_RS09160 (KUO14_09160) | - | 1844249..1844455 (-) | 207 | WP_116491842.1 | hypothetical protein | - |
| KUO14_RS09165 (KUO14_09165) | - | 1844469..1845053 (-) | 585 | WP_010711679.1 | DUF3850 domain-containing protein | - |
| KUO14_RS09170 (KUO14_09170) | - | 1845065..1845313 (-) | 249 | WP_002415426.1 | hypothetical protein | - |
| KUO14_RS09175 (KUO14_09175) | - | 1845310..1845663 (-) | 354 | WP_002415427.1 | hypothetical protein | - |
| KUO14_RS09180 (KUO14_09180) | - | 1845813..1846547 (-) | 735 | WP_249455863.1 | N-6 DNA methylase | - |
| KUO14_RS09185 (KUO14_09185) | - | 1846858..1847286 (-) | 429 | WP_164549300.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KUO14_RS09190 (KUO14_09190) | - | 1847283..1848236 (-) | 954 | WP_116491844.1 | phage replisome organizer N-terminal domain-containing protein | - |
| KUO14_RS09195 (KUO14_09195) | - | 1848240..1848920 (-) | 681 | WP_116491845.1 | putative HNHc nuclease | - |
| KUO14_RS09200 (KUO14_09200) | - | 1848917..1849855 (-) | 939 | WP_116491846.1 | DUF1351 domain-containing protein | - |
| KUO14_RS09205 (KUO14_09205) | - | 1849840..1850517 (-) | 678 | WP_116491847.1 | ERF family protein | - |
| KUO14_RS09210 (KUO14_09210) | - | 1850510..1850755 (-) | 246 | WP_116491848.1 | hypothetical protein | - |
| KUO14_RS09215 (KUO14_09215) | - | 1850935..1851258 (-) | 324 | WP_002368201.1 | hypothetical protein | - |
| KUO14_RS09220 (KUO14_09220) | - | 1851331..1852074 (-) | 744 | WP_002368200.1 | hypothetical protein | - |
| KUO14_RS09225 (KUO14_09225) | - | 1852087..1852494 (-) | 408 | WP_002363338.1 | hypothetical protein | - |
| KUO14_RS09230 (KUO14_09230) | - | 1852563..1852763 (-) | 201 | WP_116491849.1 | hypothetical protein | - |
| KUO14_RS09235 (KUO14_09235) | - | 1852774..1852959 (-) | 186 | WP_099704312.1 | hypothetical protein | - |
| KUO14_RS09240 (KUO14_09240) | - | 1852970..1853683 (-) | 714 | WP_116491850.1 | Rha family transcriptional regulator | - |
| KUO14_RS09245 (KUO14_09245) | - | 1853722..1854039 (-) | 318 | WP_002356999.1 | hypothetical protein | - |
| KUO14_RS09250 (KUO14_09250) | - | 1854045..1854236 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| KUO14_RS09255 (KUO14_09255) | - | 1854529..1854870 (+) | 342 | WP_002396615.1 | helix-turn-helix domain-containing protein | - |
| KUO14_RS09260 (KUO14_09260) | - | 1854875..1855522 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KUO14_RS09265 (KUO14_09265) | - | 1855640..1856404 (+) | 765 | WP_229077509.1 | LysM domain-containing protein | - |
| KUO14_RS09270 (KUO14_09270) | - | 1856419..1856748 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| KUO14_RS09275 (KUO14_09275) | - | 1856823..1857971 (+) | 1149 | WP_116491852.1 | site-specific integrase | - |
| KUO14_RS09280 (KUO14_09280) | comGD | 1857999..1858442 (-) | 444 | WP_116491816.1 | competence type IV pilus minor pilin ComGD | - |
| KUO14_RS09285 (KUO14_09285) | comGC/cglC | 1858439..1858714 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=586331 KUO14_RS09285 WP_002356991.1 1858439..1858714(-) (comGC/cglC) [Enterococcus faecalis strain SY-1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=586331 KUO14_RS09285 WP_002356991.1 1858439..1858714(-) (comGC/cglC) [Enterococcus faecalis strain SY-1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |