Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | TL13_RS00955 | Genome accession | NC_021213 |
| Coordinates | 152656..153051 (+) | Length | 131 a.a. |
| NCBI ID | WP_015646304.1 | Uniprot ID | A0A0Z8MGY0 |
| Organism | Streptococcus suis TL13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 131334..155798 | 152656..153051 | within | 0 |
Gene organization within MGE regions
Location: 131334..155798
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TL13_RS00815 (TL13_0162) | - | 131334..132008 (-) | 675 | WP_015646277.1 | head maturation protease, ClpP-related | - |
| TL13_RS00820 (TL13_0163) | - | 131998..132489 (-) | 492 | WP_015646278.1 | hypothetical protein | - |
| TL13_RS00825 (TL13_0164) | - | 132502..133017 (-) | 516 | WP_041179361.1 | hypothetical protein | - |
| TL13_RS10750 (TL13_0165) | - | 133165..133332 (-) | 168 | WP_015646280.1 | hypothetical protein | - |
| TL13_RS00830 (TL13_0166) | - | 133376..133834 (-) | 459 | WP_015646281.1 | hypothetical protein | - |
| TL13_RS00835 (TL13_0167) | - | 133838..134299 (-) | 462 | WP_015646282.1 | hypothetical protein | - |
| TL13_RS00840 (TL13_0168) | - | 134296..135135 (-) | 840 | WP_015646283.1 | ATP-binding protein | - |
| TL13_RS10055 (TL13_0169) | - | 135147..135998 (-) | 852 | WP_015646284.1 | phage replisome organizer N-terminal domain-containing protein | - |
| TL13_RS00855 (TL13_0170) | - | 135988..136266 (-) | 279 | WP_015646285.1 | hypothetical protein | - |
| TL13_RS00860 | - | 136259..136531 (-) | 273 | WP_330217389.1 | hypothetical protein | - |
| TL13_RS10755 (TL13_0171) | - | 136614..136781 (-) | 168 | WP_015646286.1 | hypothetical protein | - |
| TL13_RS00870 (TL13_0172) | - | 136995..137423 (-) | 429 | WP_015646287.1 | hypothetical protein | - |
| TL13_RS00875 (TL13_0173) | - | 137857..138087 (-) | 231 | WP_015646288.1 | hypothetical protein | - |
| TL13_RS00880 (TL13_0174) | - | 138100..138720 (-) | 621 | WP_015646289.1 | Rha family transcriptional regulator | - |
| TL13_RS00885 (TL13_0175) | - | 138777..138983 (-) | 207 | WP_015646290.1 | helix-turn-helix transcriptional regulator | - |
| TL13_RS10830 (TL13_0176) | - | 139129..139860 (+) | 732 | WP_015646291.1 | helix-turn-helix domain-containing protein | - |
| TL13_RS00895 (TL13_0177) | - | 140478..141968 (+) | 1491 | WP_015646292.1 | ATP-binding protein | - |
| TL13_RS00900 (TL13_0178) | - | 142284..143429 (+) | 1146 | WP_015646293.1 | tyrosine-type recombinase/integrase | - |
| TL13_RS00905 (TL13_0179) | comYH | 143526..144479 (+) | 954 | WP_015646294.1 | class I SAM-dependent methyltransferase | Machinery gene |
| TL13_RS00910 (TL13_0180) | - | 144529..145716 (+) | 1188 | WP_015646295.1 | acetate kinase | - |
| TL13_RS00915 (TL13_0181) | - | 146029..146580 (+) | 552 | WP_015646296.1 | folate family ECF transporter S component | - |
| TL13_RS00920 (TL13_0182) | - | 146636..147898 (+) | 1263 | WP_015646297.1 | bifunctional folylpolyglutamate synthase/dihydrofolate synthase | - |
| TL13_RS00925 (TL13_0183) | pepA | 148039..149100 (-) | 1062 | WP_015646298.1 | glutamyl aminopeptidase | - |
| TL13_RS10570 | - | 149242..149346 (+) | 105 | WP_125175873.1 | type I toxin-antitoxin system Fst family toxin | - |
| TL13_RS00930 (TL13_0184) | - | 149546..149830 (+) | 285 | WP_015646299.1 | DUF4651 domain-containing protein | - |
| TL13_RS00935 (TL13_0185) | - | 149827..150147 (+) | 321 | WP_015646300.1 | thioredoxin family protein | - |
| TL13_RS00940 (TL13_0186) | - | 150191..151147 (+) | 957 | WP_015646301.1 | DUF1002 domain-containing protein | - |
| TL13_RS00945 (TL13_0187) | ytpR | 151166..151789 (+) | 624 | WP_015646302.1 | YtpR family tRNA-binding protein | - |
| TL13_RS00950 (TL13_0188) | - | 151822..152601 (-) | 780 | WP_015646303.1 | DUF2785 domain-containing protein | - |
| TL13_RS00955 (TL13_0189) | ssbA | 152656..153051 (+) | 396 | WP_015646304.1 | single-stranded DNA-binding protein | Machinery gene |
| TL13_RS10760 (TL13_0190) | - | 153518..153685 (-) | 168 | WP_015646305.1 | hypothetical protein | - |
| TL13_RS00960 (TL13_0191) | groES | 153883..154164 (+) | 282 | WP_015646306.1 | co-chaperone GroES | - |
| TL13_RS00965 (TL13_0192) | groL | 154176..155798 (+) | 1623 | WP_014637331.1 | chaperonin GroEL | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14837.68 Da Isoelectric Point: 5.0026
>NTDB_id=58614 TL13_RS00955 WP_015646304.1 152656..153051(+) (ssbA) [Streptococcus suis TL13]
MYNKVIAIGRLTAQPELTQTPNGKNLTRVTVAVNRRFKTENGEREADFLNVIFWGKLAETLVSYGSKGSLISIDGELRTR
KYEKDGSNHYVTEILGQSFQLLESRAQRAMRENNTGDDLADLVLEEEELPF
MYNKVIAIGRLTAQPELTQTPNGKNLTRVTVAVNRRFKTENGEREADFLNVIFWGKLAETLVSYGSKGSLISIDGELRTR
KYEKDGSNHYVTEILGQSFQLLESRAQRAMRENNTGDDLADLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=58614 TL13_RS00955 WP_015646304.1 152656..153051(+) (ssbA) [Streptococcus suis TL13]
ATGTATAATAAAGTTATTGCAATCGGTCGCTTGACGGCCCAACCCGAACTCACTCAAACCCCTAACGGCAAAAATCTGAC
CCGTGTAACAGTCGCAGTCAATCGCCGATTTAAGACTGAAAATGGTGAGCGTGAAGCAGATTTTCTTAATGTTATTTTCT
GGGGCAAACTGGCGGAAACACTTGTCTCCTATGGTAGCAAGGGTAGTCTGATTTCTATTGACGGTGAGTTGCGAACGCGA
AAATACGAAAAAGACGGCAGCAACCACTATGTGACTGAAATCTTAGGACAATCCTTCCAGTTGCTCGAAAGCCGTGCCCA
ACGTGCCATGCGTGAAAACAATACTGGTGATGACCTAGCTGACTTGGTTCTGGAAGAGGAGGAATTACCGTTTTAA
ATGTATAATAAAGTTATTGCAATCGGTCGCTTGACGGCCCAACCCGAACTCACTCAAACCCCTAACGGCAAAAATCTGAC
CCGTGTAACAGTCGCAGTCAATCGCCGATTTAAGACTGAAAATGGTGAGCGTGAAGCAGATTTTCTTAATGTTATTTTCT
GGGGCAAACTGGCGGAAACACTTGTCTCCTATGGTAGCAAGGGTAGTCTGATTTCTATTGACGGTGAGTTGCGAACGCGA
AAATACGAAAAAGACGGCAGCAACCACTATGTGACTGAAATCTTAGGACAATCCTTCCAGTTGCTCGAAAGCCGTGCCCA
ACGTGCCATGCGTGAAAACAATACTGGTGATGACCTAGCTGACTTGGTTCTGGAAGAGGAGGAATTACCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
76.336 |
100 |
0.763 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
75.573 |
100 |
0.756 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
72.519 |
100 |
0.725 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
72.519 |
100 |
0.725 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
72.519 |
100 |
0.725 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
72.519 |
100 |
0.725 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
72.519 |
100 |
0.725 |
| ssbB/cilA | Streptococcus mitis SK321 |
71.756 |
100 |
0.718 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
63.393 |
85.496 |
0.542 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
44.248 |
86.26 |
0.382 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.17 |
80.916 |
0.382 |